KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3428Help
Entry
Rru_A3428         CDS       T00310                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rru_A3428
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rru_A3428
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rru_A3428
Enzymes [BR:rru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rru_A3428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3945911..3946726
Genome map
AA seq 271 aa AA seqDB search
MSATTPTTDRLSRRFAALKAEGRGGLVTYVMAGDPDQETALALMRGLPGAGADIIELGMP
FSDPMADGPAIQAAALRALAAGMTLTGTLETLKAFRATDDDTPVVLMGYYNPIHYYGAEA
FARDAALAGADGLIIVDLPPEEADELLPFLRAQGLHLIMLATPTTDEARLPAILERASGF
LYYVSIAGITGTAAADAGGVAQAVARIRRKTDLPIAIGFGVSTPAQAATMARVGDAAVVG
SAIVRRLAEGGDVLGFVGELAGALRKVDAAG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccaccacgccgaccaccgatcgcctctcccgccgcttcgccgccctcaaggcc
gaaggccgggggggccttgtcacctatgtcatggccggcgatcccgaccaggaaacggcc
ctcgccctgatgcgcggcctgcccggcgccggggccgatatcatcgaattgggaatgccg
ttttccgatccgatggccgatggcccggcgatccaggccgccgccctgcgcgccctggcc
gccgggatgaccctgacggggaccttggaaaccctgaaggcgttccgcgccaccgatgat
gacaccccggtggttctgatgggctattacaatcccatccattattacggggccgaggcc
ttcgcccgcgacgccgccctggccggcgccgacggcctgatcatcgtcgacctgccgccc
gaggaggccgacgagcttctacccttcctgcgcgcccagggtctgcatctgatcatgctg
gcgacgccgaccaccgatgaggcgcggctgccggcgattctcgagcgggcgagcgggttt
ctttattatgtttcgatcgccggcatcaccggaacggccgccgccgatgccgggggcgtc
gcccaggcggtcgcccgcatccgccggaaaaccgatctgccgatcgccatcggctttggc
gtatccaccccggcccaggcggcgacgatggcgcgggtcggtgatgccgccgtggtcggt
tcggccattgtccgccggctggccgagggcggggacgtgctgggcttcgttggcgaattg
gccggcgccctgcgcaaggtcgacgcggcggggtaa

DBGET integrated database retrieval system