KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3428Help
Entry
Rru_A3428         CDS       T00310                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00260  Glycine, serine and threonine metabolism
rru00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01130  Biosynthesis of antibiotics
rru01230  Biosynthesis of amino acids
Module
rru_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rru_A3428
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rru_A3428
Enzymes [BR:rru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rru_A3428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-GeneID: 3836880
NCBI-ProteinID: YP_428509
UniProt: Q2RNS3
Position
3945911..3946726
Genome map
AA seq 271 aa AA seqDB search
MSATTPTTDRLSRRFAALKAEGRGGLVTYVMAGDPDQETALALMRGLPGAGADIIELGMP
FSDPMADGPAIQAAALRALAAGMTLTGTLETLKAFRATDDDTPVVLMGYYNPIHYYGAEA
FARDAALAGADGLIIVDLPPEEADELLPFLRAQGLHLIMLATPTTDEARLPAILERASGF
LYYVSIAGITGTAAADAGGVAQAVARIRRKTDLPIAIGFGVSTPAQAATMARVGDAAVVG
SAIVRRLAEGGDVLGFVGELAGALRKVDAAG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccaccacgccgaccaccgatcgcctctcccgccgcttcgccgccctcaaggcc
gaaggccgggggggccttgtcacctatgtcatggccggcgatcccgaccaggaaacggcc
ctcgccctgatgcgcggcctgcccggcgccggggccgatatcatcgaattgggaatgccg
ttttccgatccgatggccgatggcccggcgatccaggccgccgccctgcgcgccctggcc
gccgggatgaccctgacggggaccttggaaaccctgaaggcgttccgcgccaccgatgat
gacaccccggtggttctgatgggctattacaatcccatccattattacggggccgaggcc
ttcgcccgcgacgccgccctggccggcgccgacggcctgatcatcgtcgacctgccgccc
gaggaggccgacgagcttctacccttcctgcgcgcccagggtctgcatctgatcatgctg
gcgacgccgaccaccgatgaggcgcggctgccggcgattctcgagcgggcgagcgggttt
ctttattatgtttcgatcgccggcatcaccggaacggccgccgccgatgccgggggcgtc
gcccaggcggtcgcccgcatccgccggaaaaccgatctgccgatcgccatcggctttggc
gtatccaccccggcccaggcggcgacgatggcgcgggtcggtgatgccgccgtggtcggt
tcggccattgtccgccggctggccgagggcggggacgtgctgggcttcgttggcgaattg
gccggcgccctgcgcaaggtcgacgcggcggggtaa

DBGET integrated database retrieval system