KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3471Help
Entry
Rru_A3471         CDS       T00310                                 

Definition
RecR protein
Orthology
K06187  
recombination protein RecR
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rru03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3995618..3996211)
Genome map
AA seq 197 aa AA seqDB search
MSAGEIDRLIGLLARLPGLGPRSARRAALHLLKRRESLMDPLMEALGAVAASVRLCPVCG
TLDTRAPCSICADPRRDGTLICVVRDVADLWALERGGVFSGRYHVLGGLLSAIDGVGPED
LGLDRLAARVAEGPVVEVILALPATVEGQTTAHVIADLIEPKGITVSGLAQGVPVGGELD
YLDDGTLTAALRARRPV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcgggagagatcgaccgtctgatcggcctgctggcccgactgcccggattgggt
ccccgttcggcccggcgcgccgctttgcatctgctcaagcggcgcgagagcctgatggac
cccttgatggaggccctgggcgcggtcgccgcctcggtccgcctctgcccggtctgcggc
actctcgacacccgcgcgccctgttcgatctgcgccgatccgcgccgcgacggaacgctg
atctgcgtggtgcgtgatgtcgccgacctctgggcccttgaacgcggcggggtgttttcc
gggcgctaccatgttctgggcgggctgctctcggcgatcgatggcgtcggtcccgaggat
cttggtcttgatcgcttggcagcccgcgtcgccgaaggcccggtggtcgaggtcatcctg
gccctgccggccaccgtcgaggggcagaccaccgcccatgtcatcgccgatcttatcgag
ccaaagggaataaccgtatcgggattggcccagggggttcccgtgggcggcgagttggac
tatctggacgatggcaccctgaccgccgccctgcgcgcccgtcgcccggtttga

DBGET integrated database retrieval system