KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3480Help
Entry
Rru_A3480         CDS       T00310                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rru_A3480
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rru_A3480
Enzymes [BR:rru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rru_A3480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4004973..4006187
Genome map
AA seq 404 aa AA seqDB search
MSALPLRWTAAELADPLALARALVACPSVTPRDAGALDVLESALIALGFRCVRLPFGAEG
GERVDNLYARRGGAGPCFGFAGHTDVVPAGDGWSRPPFGAEVVDGALVGRGAADMKGGIA
CFVAAVARLISGPDSTGSISRHDPTGSIALLITGDEEGPALHGTRKVLEWMEGAGERMDL
CLVGEPTNPEGLGDMIKIGRRGSLTATVTLLGRAGHVAYPHLADNPLHRLSTLTGLLLAE
TLDDGTAHFQPSSLQLTSIDVGNPAANVIPAKATLRFNIRFNDRHSGESLSAWIRARCLA
ACDGDESGFSLVLEHSGDAFLTPPGPLSDLIATACQAVTGRRPELSTSGGTSDARFIRSH
CPVAEFGLVGRTMHKPDERVAVADLEALSEIYRRVLVGFFEAPC
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgcgcttccccttcgctggactgcggccgaattggccgatcccttggctttggcc
cgggcgctggtggcttgccccagcgtcaccccgcgtgatgccggggcccttgatgttctt
gaatccgccctgatcgccttgggcttccgctgcgttcgcctgccctttggcgccgagggc
ggcgagagggtggataatctgtatgcccgccgcggcggcgccggcccctgtttcggattc
gccggccatacggatgtcgtgcccgccggcgacggctggagccggccgccctttggcgcc
gaagtggtcgatggtgccctggtcggccggggagcggccgatatgaaaggcggcatcgcc
tgtttcgtcgccgccgtcgcccggttgatttccggacccgattccacgggatcgatttcc
agacacgatcccacgggatcgatcgccctgctgatcaccggcgacgaggagggccccgcc
cttcacggcacccgcaaggtgctggagtggatggagggggctggcgaaaggatggatctg
tgtttggttggcgagccgaccaatcccgaaggcctgggcgacatgatcaagatcggtcgg
aggggcagcctgaccgccaccgtcacccttctcggccgcgccggccatgtcgcctatccc
catctcgccgataacccccttcatcggctctcgacgttgaccggcctgctgctggccgag
accctggacgacggcacggcgcatttccagccttctagcctgcagctgaccagcatcgat
gtcggcaatccggccgccaatgtcattcccgccaaggccaccttgcgcttcaatatccgc
ttcaacgatcgccatagcggcgagtcgctgtcggcctggatccgcgcccgctgtctggcg
gcctgcgatggcgacgaaagcggcttttccctggttttggagcatagcggcgatgccttc
ctgacgccgcccggcccgctgtcggatctgatcgccacggcctgtcaggcggtcaccggc
cggcggccggagctgtcgacctcgggcggcacctccgatgcccgtttcattcgcagccat
tgcccggtggccgaattcggtctggtcgggcgaaccatgcacaagcccgatgaacgggtg
gcggtggccgatctcgaagccttaagcgagatctaccgccgggttctggtcggtttcttc
gaggccccatgctga

DBGET integrated database retrieval system