KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3567Help
Entry
Rru_A3567         CDS       T00310                                 

Definition
uroporphyrinogen III synthase HEM4 (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rru00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4111106..4113310)
Genome map
AA seq 734 aa AA seqDB search
MRALITRPLEDADRIGALLRARGADVFLEPLLIILPAAAPGLDLTDAQALVFTSANGVRA
FADRNALRRLPVYAVGETTGTVASAYGFPDVRIAGGDVRALASLILAQASPDAGPLVHIS
GTNVAGDLAGSLGAHGFTVRRERLYEARPAAAFSKELKTAFVERSMPAVFLFSPRTARTF
AGLVHKADLLSAMTDVTVYALSPAVADALEGLPLGAVRVAAEPTQDALLGLFDADLSVGR
SPAAAVRAEHLESTKEGGPLVMTTGSKEDRPEDGDRPEDKAAEIRAGDSVVAAGAPSSGP
VVEPAVAAGTSADQAGERVETESQPWGGSKAVVETDETDAAYGGSAGEAGASEAEAEEEP
PKKSHALTYFVLLLLVAAGAAGSYPWWRNEVPEVVRVYLPELPGAPVSPEVAALKGSVDD
LGGRLASVESAVADLRAQVSQAPGVPADIADRINSLEARISGLDGQPAPAPVSGGASVDS
GAVSALQGDLQATKDSVSGFDAKVADLDKKLAEVKNDQVAPSTVLALAGRLTEVEGIARQ
ANTRRNTALALLLAVGQLREAANQGEAFDDELRSVHAIVQDGADVAPGIETLTPLATTGV
STRAALAARFDDVSRAISQAVLSPEGDTWLERTFAALTSVVTVRRVDQGAGTGAEGPLAI
LAEAERLVLENDLAGAVAALKGLDGAAAEAASPWLQAAEDKLTAEAALSDLTAQALARIG
AVNATEPATPGTEG
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttattacacgtcctttggaagacgccgatcgcatcggcgcgctcttgcgc
gcgcggggtgccgacgtttttcttgaacccttactgatcattctgccggccgcggctccc
ggccttgatctgacggacgcccaggcgctggttttcaccagcgccaacggcgttcgcgcc
ttcgccgatcgcaatgccctgcggcggctgccggtctatgccgttggcgagaccaccggc
acggtggcctcggcctatggctttcccgacgtgcgcatcgcggggggcgatgtgcgggct
ctggcctcgctgatcctcgcccaggccagtcccgacgccggaccgctggttcacatctcg
ggaaccaacgtcgccggcgatctggcgggcagcctgggcgcccacgggtttaccgttcgc
cgggagcgcctttacgaggcgcggccggccgcggctttttccaaagagttgaaaaccgct
ttcgtcgaacgatcgatgccggcggttttcctgttttctccacgcaccgccaggaccttc
gccgggttggtccataaggcggatctgctttcggcgatgaccgatgtcaccgtctacgcg
ctcagcccggccgtcgccgacgccttggaggggctcccgctcggggccgtccgggtggcg
gccgaaccgactcaggacgcgcttctcggcttgttcgacgccgacctctcggtcggaaga
tcgccagccgccgcggtccgtgcagaacacctggaatcgaccaaagaagggggacccctg
gtcatgaccactggatccaaagaagatcgtcccgaggatggggaccgtcccgaggataag
gcggccgaaatacgggccggcgacagcgtagtggcggcgggggctccgtcctccgggccc
gtggttgaaccggccgtcgcggcgggaacctcggcggatcaggctggggagcgggtcgag
acggaaagccagccttggggtggctcgaaggccgtggtcgagaccgacgaaaccgatgcc
gcctatggcggatcggcgggcgaggccggcgcctccgaggccgaggccgaggaagagccc
cccaagaaaagccacgccctgacctatttcgtcttgctgctgctcgtggccgccggggcc
gctggatcctacccctggtggcggaacgaggttcccgaggtcgtgcgggtttacctgccc
gaactgcccggcgctccggtcagcccggaagtcgccgccctcaagggctcggtcgatgat
ttgggcggccgtctggcctcggtcgaaagcgccgtcgccgatctgcgggcccaggtctcc
caggcccccggcgttccggccgatatcgccgaccgcatcaacagcctggaagcccgtatt
tccggccttgacggccagcccgctccggcgccggtcagcggtggcgccagcgttgacagc
ggcgcggtcagcgccctgcagggcgatctccaggccaccaaggacagcgtcagcggcttt
gacgccaaggtcgccgatctcgacaagaagctggccgaggtcaagaacgatcaggtcgcc
ccgtccaccgtgctggccttggccggccggctgaccgaggtcgagggcatcgcccgtcag
gccaatacccggcgcaacacggcgctcgccctgctgctggccgttggccagctgcgcgag
gcggccaaccagggtgaagccttcgacgatgagctgcgcagcgttcacgccatcgttcag
gacggcgccgatgtcgcccccggcatcgagacgctgaccccgctggccaccaccggcgtt
tccacccgcgccgccctcgccgcccgcttcgacgacgtgtcgcgcgccatttcccaggcc
gtgctgtcgcccgaaggcgatacttggcttgagcggacctttgcggccttgaccagcgtc
gtcaccgtccgtcgcgtcgatcagggcgcgggcaccggcgccgaagggcccttggccatt
ctcgccgaagccgagcgtctggttctcgaaaacgatctggccggcgccgtcgcggcgctc
aagggtctggacggggccgccgccgaggccgcttcgccctggctgcaggcggccgaggac
aagctgacggccgaagccgcgctgtcggatctgacggcccaggccctcgcccgcatcggc
gcggtgaacgccaccgagccggccactccgggcacggaagggtaa

DBGET integrated database retrieval system