KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3799Help
Entry
Rru_A3799         CDS       T00310                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rru03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4349659..4350504
Genome map
AA seq 281 aa AA seqDB search
MPELPEVETVRLGLTPALVGERLSRVAARRPALRLPIPVDLVQRLTGKVVGSLDRRAKYL
LLRMIDGPVALIHLGMSGSMTVGPLAGHAEPGPHDHILFETEAGLRVTFRDPRRFGLITL
AEPETLDDHPLLAKLGPEPLSEAFDAEVLVRRLNGRQAPIKAALLDQGVVAGLGNIYVSE
ALFRAGISPLRPAASVTGAWAEALVAAIRAVLGEAIAAGGSSLRDHRQTDGALGYFQHRF
AVYDRVGQPCPGCDCDVARTGGIERMVQSGRSTFFCGRRQR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattacccgaagtggaaaccgtgcgcttgggcttgaccccggctcttgtcgga
gaacggctaagccgggtggcggcgcgacggccggcgctgcgtctgccgatcccggtcgat
ctggtccaacggctgaccggaaaggttgtcggtagtctcgatcgccgggctaagtatctg
ttattacgcatgatcgatgggccggtggcgctgatccatcttggcatgtcgggcagcatg
accgttgggccgctggccggtcatgccgaaccggggccccatgatcatattttgttcgaa
accgaggctggcctgcgcgtcacctttcgcgacccccggcgcttcggtctgatcaccctg
gccgagcccgagactctggatgatcacccgctgctggccaagcttggtcccgagccgctg
tccgaggctttcgacgccgaggtcctggtgcgccggctgaacggccgtcaggcgccgatc
aaggcggcgctgcttgatcagggcgtggtggccgggcttggcaatatctatgtcagcgag
gccttgttccgcgccggcatttcgccgctgcgcccggcggccagcgtcaccggcgcctgg
gccgaggcgctggtggcggcgattcgcgccgttttgggcgaagccatcgccgcgggcggc
tcgtcgttgcgcgaccatcgccagaccgatggggctttgggctattttcagcaccgcttc
gccgtttacgatcgcgtcggccaaccctgcccgggctgcgactgcgatgtggcgcggacc
ggcggcatcgaacggatggtccagtccgggcgatccacctttttctgcgggcgtcgtcag
cggtga

DBGET integrated database retrieval system