KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3801Help
Entry
Rru_A3801         CDS       T00310                                 

Definition
(RefSeq) short-chain enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Rru_A3801
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rru_A3801
   00650 Butanoate metabolism
    Rru_A3801
  Lipid metabolism
   00071 Fatty acid degradation
    Rru_A3801
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rru_A3801
   00310 Lysine degradation
    Rru_A3801
   00360 Phenylalanine metabolism
    Rru_A3801
   00380 Tryptophan metabolism
    Rru_A3801
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rru_A3801
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rru_A3801
   00281 Geraniol degradation
    Rru_A3801
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rru_A3801
   00627 Aminobenzoate degradation
    Rru_A3801
   00930 Caprolactam degradation
    Rru_A3801
Enzymes [BR:rru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rru_A3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4351096..4351872
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETNGKVGIVTLNRPKALNALSAGLVRDLGAALDAFEADVNVHVIVLTGSDKA
FAAGADIKEMAEKSYMDAYLEDFITKGWERVTTCRKPIIAAVAGFALGGGCEMAMMCDFI
IAAQNAKFGQPEINLGTLPGAGGTQRLTRFVGKSKAMDMCLTGRMMDADEAWKCGLVSRI
VPVDDLKDEVLKIAEAIADKSLPITMMVKEAVNAAYETTLAQGVRFERRLFQASFATDDQ
KEGMNAFIEKRQPSFTDR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgaaaacattctcgtggaaaccaacggtaaagtgggcatcgtcacgctcaac
cggcccaaggcgctcaatgccctttcggccgggttggtccgcgatctcggcgccgccctc
gacgccttcgaggccgatgtgaacgtccacgtcatcgtcctgaccggctcggacaaggct
ttcgccgccggcgccgatatcaaggagatggccgaaaagtcctatatggacgcctatctc
gaagacttcatcaccaagggctgggagcgggtgaccacctgccgcaagccgatcatcgcc
gccgtggccggattcgccctgggcggtggctgcgagatggcgatgatgtgcgatttcatc
atcgccgcccagaacgccaaattcggccagcccgaaatcaacctgggcaccctgcccggc
gccggcggcacccagcgtctgacccgcttcgtcggcaagtccaaggcgatggacatgtgt
ctgaccgggcggatgatggatgccgacgaggcttggaaatgcggcctcgtcagccgcatc
gtcccggtggacgatctcaaggacgaggtgctgaagatcgccgaggcgatcgccgataaa
agcctgccgatcaccatgatggtcaaggaggcggtcaatgccgcctatgagaccaccctg
gcccagggtgtccgattcgagcgccggcttttccaggcgagtttcgccaccgacgaccag
aaggaaggcatgaacgccttcatcgaaaagcgtcagcccagtttcaccgaccgctga

DBGET integrated database retrieval system