KEGG   Renibacterium salmoninarum: RSal33209_0037Help
Entry
RSal33209_0037    CDS       T00641                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
rsa  Renibacterium salmoninarum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rsa00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rsa00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:rsa00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(34994..36685)
Genome map
AA seq 563 aa AA seqDB search
MSSLVHRRDAGRPVHYEGDHAGAYTDVYSLMYAPVPALLSIAQDLPTQLYNCSVAESIRQ
RGKPFLLCEYVHAMGNGPGAIDQYEDLVWQHPRLHGGFVWEWRDHGLLTRTPAGKPFYGY
GGDFGEVVHDGNFVMDGMILSDETPTPGLHEYKAVVQPILFSFDADSVRLSNLRHSADTS
DLEFSWTIDRDGEQHSSGILALPQISAGDDAIVPMPPTPDATGELWLTVTAALKAPTNWA
EAGHIVASAQNQIQAAVVTAVPARPLGVVMNNGVSETIRLGSAVFSHGVLTELAGLEIAG
PQLQLWRAPTDNDEGASFGNYDDGDPVATGGWGKPGPAVAALWHSAGLDRLEHRLDAQEV
GEGFVRTVTRSAAADSREYVRSTVLWQFVDDELVLGIDIEPSRGWTSVWPRIGVRFDLPA
VIDGARWFGQGPAESYPDSMRAAAVGRFELGIDALSAGYARPQETGHRSGLRELDLLAAG
QRRLSIRAFADQQGRRPGFTLFRYTAEELTAAGHPHELPTSSGSYLYLDAAQHGLGSRAC
GPDVWPSYTLRPEARSITLRILA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccttggtgcatcggcgggacgcgggccgtccggtgcactacgaaggtgatcat
gcgggcgcatatacggacgtttactcgctgatgtatgcgccggttccggctttgctttcc
attgcacaagacttgccaactcagctctataactgttcagttgctgaatctattcgccag
cgcggcaagccgttcttgctttgtgaatacgtgcacgcgatgggtaatggcccgggcgcg
attgatcagtatgaagatctagtgtggcagcatccacgcttgcacggcggattcgtttgg
gaatggcgtgatcacggcctgctgacccgcaccccagcagggaagcctttttatggttat
ggcggcgactttggcgaagtggttcatgatggcaatttcgtgatggatggcatgattctc
agcgatgaaacgcctacaccgggattgcatgagtacaaagctgtggtgcagccgatcctg
ttcagtttcgatgcggattcggtgcggctgagcaatttgcggcattccgctgatacttcg
gatctggaatttagctggactatcgaccgtgatggggagcagcattcgagcgggattttg
gcgctcccacagatatcggccggtgacgatgccattgttccgatgccgccgactcccgat
gccactggcgaattgtggttaaccgtcaccgccgctttgaaagcgccaactaactgggcg
gaagcaggacacattgtggcttccgcgcagaaccagattcaggctgctgtggtaacggct
gtgccagcaaggccgcttggcgttgttatgaataatggggtgagcgagactattcgactt
gggtcggcggtttttagccacggggtgctgactgaacttgctggcctagaaattgccggc
ccacaattgcagctgtggcgtgcgccaaccgataacgatgaaggcgcgtcgtttgggaac
tacgacgacggcgatccggttgccaccggtgggtgggggaagcccggacctgccgttgcg
gctctttggcatagcgcaggcttagatcgcttggagcatcgattggatgcgcaagaagtt
ggcgaaggcttcgtgcgtaccgtgaccagatcggccgcggcagattctcgggaatacgtg
cgtagcactgtgctgtggcagtttgttgatgatgagttggtgctggggatcgacattgag
ccttcgcggggttggacttcggtgtggccccggatcggcgtacggtttgatctacctgca
gtgatcgacggcgcgcgctggtttggccaaggacctgctgagtcttacccggacagcatg
cgggctgctgccgtaggtcgcttcgagctaggtattgatgcgctgtcggccggttatgcg
cggccgcaggaaaccggtcatcgctcgggcttacgtgagctggatttgctggctgcgggt
cagcggcgattgtcgatccgggcatttgccgaccaacaagggcggcgaccaggtttcacc
ttgtttcgttacacggctgaggaactaaccgcagccggacacccgcatgagttgccgacg
tcgtccggttcctatctttatttggatgcggcacagcacgggcttggctcgcgggcttgc
gggccggacgtttggccgagctatacgctacggccagaggctcgaagcatcaccctgagg
atcttggcttag

DBGET integrated database retrieval system