KEGG   Renibacterium salmoninarum: RSal33209_0148Help
Entry
RSal33209_0148    CDS       T00641                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rsa  Renibacterium salmoninarum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RSal33209_0148
  Lipid metabolism
   00561 Glycerolipid metabolism
    RSal33209_0148
   00600 Sphingolipid metabolism
    RSal33209_0148
Enzymes [BR:rsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RSal33209_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(127783..129162)
Genome map
AA seq 459 aa AA seqDB search
MSLSYSVPLGAQFAQFHRGGTSVVVECADARMPRIIYWGAAIDQNGPLATAELAALSLAG
APQRVSGGIDLPARLSLLPQESEGSQHLPGLQGHRAGRAAFPDFRVQKFDVGKNHVAIQA
VDSDAELLLDVELELTASGLLRQRLSVQNTGESRYEVIALNSTFPFPANATEILDTTGRH
LKERSPQRRSLTVGAHVREGRRGRTGADGPLLLAAGTSGFGFNRGTVHAVHLAWSGNYRL
SAERTVEADNFFSAAELLLPGEMTLAAGESYQTPWAVGAWGAGLDDLAARFHQDLRARPQ
HPKAPRPVTLNSWEAVYFDHDLERLKEIVAAATSVGIERFVLDDGWFGSRRDDTSGLGDW
QVSTDVWPTGLGPLVEAVRAAEMQFGLWFEPEYGQSRQRSGSKSSGMDSASHRRRPGSLA
GGCPQSTGCELRRGGLAIPFRRDQRRRRQAFDRLFEMGS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttagctactccgtgccattaggagctcaattcgcccaatttcaccgaggtgga
actagcgtcgtcgtggaatgcgcggacgcccgaatgccacgcattatctactggggtgcc
gccattgatcagaatggaccgctagctaccgcggagctggcagcactgtctttggctggt
gcgccgcaacgcgtctccggcggcatcgatctaccggccagactgagcttgctcccgcag
gaatctgagggctcgcaacacttacctgggctgcaggggcaccgggcagggcgcgccgcc
ttccctgattttcgcgtgcagaaattcgacgtcggcaagaaccacgtcgcaattcaggca
gttgattctgacgccgagctactgctagacgtcgaactggagttgacagcttctggtctg
ctccgtcaacgactcagcgtgcaaaacaccggcgaatcccgctacgaagtcatcgcgctt
aactcaacgtttcccttccctgcgaacgctaccgaaatcttggataccaccgggcggcat
ctcaaagagcgcagcccacaacgccgctcactcacggtcggtgctcatgttcgtgaagga
cgccgcggacgcaccggggctgatggcccactgctactagccgccggcacttcaggtttt
ggcttcaaccgcggcactgtgcacgcggtgcatttggcctggagcggaaactatcgactg
agtgcagagcgaaccgtggaagcggacaacttcttcagcgccgccgaattgctgctgccg
ggggaaatgactctggcagcgggcgaaagctatcagacgccctgggccgtcggtgcgtgg
ggagctggactcgatgaccttgccgcccgcttccatcaagatctacgcgcacgtccgcaa
caccccaaagcaccgcgtccggtcacactcaacagctgggaagcggtctacttcgatcac
gatcttgagcggctcaaggaaattgttgccgctgccacttcagtaggcattgagcgtttt
gtgctcgacgacggctggttcggctcccgccgcgatgacacctcaggtttaggtgactgg
caggtctccaccgatgtctggcccaccggcctcggtccgctcgtggaagctgttcgcgcc
gccgagatgcaatttggtctgtggtttgagccagaatatggtcaatctcgacagcgatct
ggctcgaaatcatccggaatggattctgcatcccaccgcaggcggccaggctcgttggcc
ggtggctgcccgcaatcaacaggttgtgaacttagacgcggaggcttggcaatacctttt
cgacgcgatcagcgccgtcgtcgccaagcattcgatcgattatttgaaatgggatcataa

DBGET integrated database retrieval system