KEGG   Renibacterium salmoninarum: RSal33209_0150Help
Entry
RSal33209_0150    CDS       T00641                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rsa  Renibacterium salmoninarum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RSal33209_0150
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RSal33209_0150
Enzymes [BR:rsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RSal33209_0150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
130541..130990
Genome map
AA seq 149 aa AA seqDB search
MGRQAIFLVTKAKPCWWSTLHRSADLRRSMPGSRRSMRSTKIRASKFWACRAINLRVKNP
APTKTSPIFATKTFGVTFDLTAKADVRGKNQHPLYAELTKFKNGILPGLIKWNFEKFLVN
NDGEIVARFAPTVEPDSAEVVAAIEKQLA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgggacgccaagcgatttttctcgttacaaaggcaaaaccgtgctggtggtcaacgttg
catcgcagtgcggatttacgccgcagtatgccgggctcgaggcgctctatgagaagtaca
aagatcagggcttcgaaattttgggcgtgccgtgcaatcaatttgcgggtcaagaacccg
gcaccgacgaagacatcgccgatttttgcaacaaaaactttcggcgtaaccttcgacctg
actgccaaggctgatgtccggggcaaaaatcagcacccgctttatgctgaactgaccaag
ttcaaaaatgggattctgcccggactgatcaaatggaatttcgaaaaattcctggttaat
aacgacggcgagatcgtcgctcggtttgcgcccacggtagagccggattctgccgaagta
gttgcggcgatcgaaaaacagcttgcctaa

DBGET integrated database retrieval system