KEGG   Renibacterium salmoninarum: RSal33209_0170Help
Entry
RSal33209_0170    CDS       T00641                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rsa  Renibacterium salmoninarum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rsa01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rsa00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rsa00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(147870..148844)
Genome map
AA seq 324 aa AA seqDB search
MVRPRGWHLPEKHMLINNKPIAGGLVDFGLYFFHNAKRLIAQGKGPYFYLPKIENHLEAR
LWNDIFILAQDFLGIPQGTIRATVLIETITAAFEMEEILYELRDHASGLNAGRWDYLFSV
IKNFRTRGPRFVLPDRNEITMTAPFMRAYTEQLVRACHRRGAMAIGSMAAFIPNRRDPEA
NEIAFGKVRADKTREATDGFDGSWVAHPDLVPVAMEVFNGVLGERANQIDKLREDVVPDD
KALLNVTATEGSITESGIRMNIEVGIRYIESWLCGNGAAAIHNLMEDAATAEISRSQIWQ
WIYAEAITDQGEIISENWVRELTD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtggttcggccgcgcggctggcacttgccggaaaagcacatgctgatcaacaacaaacca
atcgcgggtggactggtcgattttggtctctacttcttccacaacgccaagcggctcatt
gcgcaggggaagggtccttacttctacttgccgaagattgaaaaccatctggaagcccgg
ttgtggaacgacatcttcattttggcgcaggattttctcggcattccgcagggcaccatc
cgagctaccgtactgatcgaaaccattaccgcagccttcgagatggaagagattctgtac
gaactgcgcgatcacgcctcgggtttgaacgcgggccgctgggattacctattctccgtg
atcaagaacttccgcacccgtggcccacgcttcgtgttgccggaccgcaatgagatcacc
atgacggcgccattcatgcgggcttacaccgagcagcttgttcgggcttgtcaccgacgt
ggcgcgatggccattggcagtatggctgctttcattccgaatcgccgggatcccgaagct
aatgaaatcgcgttcggcaaggttcgtgcggataagactcgtgaagcaactgatggcttt
gatggctcctgggtagcgcacccggatttggttccggtggctatggaggttttcaacggc
gttctgggcgagcgcgcgaatcagatcgacaagctgcgtgaagacgtggttcccgatgac
aaggcgctgctgaatgtcaccgcgaccgagggctcaatcaccgaatccggcatccgaatg
aacattgaggtgggtattcggtacatcgagtcttggttgtgtggaaatggtgcggctgcg
atccataacctgatggaagacgctgccaccgcagagatctcgcgctcgcaaatctggcag
tggatctacgccgaggccatcactgatcagggcgagattatctcggaaaactgggtgcgt
gagctgaccgactaa

DBGET integrated database retrieval system