KEGG   Renibacterium salmoninarum: RSal33209_0173Help
Entry
RSal33209_0173    CDS       T00641                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00630  Glyoxylate and dicarboxylate metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RSal33209_0173
Enzymes [BR:rsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RSal33209_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABY21929
UniProt: A9WLG9
Position
complement(149454..150524)
Genome map
AA seq 356 aa AA seqDB search
MQRDYSAADAVKLAGRVQEEATLARRGSEKLWDQLRNAGPEGYTNSLGALTGNQAAQQVK
AGLKAIYLSGWQVAADANTSGNTYPDQSLYPVNSVPTVVRRINNALLRADQIEFSEGKQS
VEDWLVPIVADAEAGFGGPLNAYELMKSMIQAGASGVHWEDQLASEKKCGHLGGKVLIPN
QQHVRTLNAARLAADVDERDQEFTTGERTAEGFYKVRNGIEPCIAMAKAYAPYADQMLAY
NCSPSFNWKKHLDDATIAKFQRELGAMGFKFQFITLAGFHALNYSMFDLAHGYARDGMSA
YVELQEKEFASEDRGYTATKHQREVGTGYFDLVAAALNPSGSTLALAGSTEAQQFH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgcgattactcggcagccgacgccgtcaagctcgccggacgcgtgcaagaagag
gccacactagcccgccgcggatcagagaagctctgggatcaactgcgcaatgccggcccg
gaaggctacactaactcacttggcgcactgaccggcaaccaggccgcacaacaggtcaag
gccggactcaaagccatttacctctccggctggcaggttgctgctgatgcaaacacttcc
ggcaacacgtacccggaccagtcgctctacccggtgaactcagttcccaccgtggttcgt
cggatcaacaacgcactacttcgcgcggatcagattgaattctccgaaggcaagcagtcc
gttgaagattggctggtcccgatcgtggccgacgccgaagctggctttggcggcccgctc
aacgcttacgaactgatgaagtcaatgatccaagctggcgcttcgggcgtgcactgggaa
gatcagctcgcctcggaaaagaagtgcggtcacttgggtggcaaggtgctcattcccaac
cagcagcacgtccgcacgctcaacgcggcccggctcgcggccgacgtcgacgagcgtgac
caagagttcaccaccggcgagcgcactgccgagggtttctacaaagtacgcaacggcatt
gaaccgtgtattgcaatggccaaggcttatgccccgtacgcggatcagatgctggcttac
aactgctcaccgtcgttcaactggaagaagcatttggacgacgccacgatcgcgaagttc
cagcgggagctcggcgcaatgggcttcaagttccagttcattaccctggctggcttccac
gccctgaattactcaatgtttgacttggctcacggttacgcccgtgatggcatgagtgct
tacgtcgaattgcaagaaaaagaattcgcctccgaagaccgcggctacaccgcaaccaag
caccaacgcgaagtgggcactggctacttcgatctggtcgcggccgccctgaaccccagc
ggcagcacgctcgccttggctggctcaactgaagcccagcaattccactaa

DBGET integrated database retrieval system