KEGG   Renibacterium salmoninarum: RSal33209_0173Help
Entry
RSal33209_0173    CDS       T00641                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rsa  Renibacterium salmoninarum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSal33209_0173
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RSal33209_0173
Enzymes [BR:rsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RSal33209_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(149454..150524)
Genome map
AA seq 356 aa AA seqDB search
MQRDYSAADAVKLAGRVQEEATLARRGSEKLWDQLRNAGPEGYTNSLGALTGNQAAQQVK
AGLKAIYLSGWQVAADANTSGNTYPDQSLYPVNSVPTVVRRINNALLRADQIEFSEGKQS
VEDWLVPIVADAEAGFGGPLNAYELMKSMIQAGASGVHWEDQLASEKKCGHLGGKVLIPN
QQHVRTLNAARLAADVDERDQEFTTGERTAEGFYKVRNGIEPCIAMAKAYAPYADQMLAY
NCSPSFNWKKHLDDATIAKFQRELGAMGFKFQFITLAGFHALNYSMFDLAHGYARDGMSA
YVELQEKEFASEDRGYTATKHQREVGTGYFDLVAAALNPSGSTLALAGSTEAQQFH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgcgattactcggcagccgacgccgtcaagctcgccggacgcgtgcaagaagag
gccacactagcccgccgcggatcagagaagctctgggatcaactgcgcaatgccggcccg
gaaggctacactaactcacttggcgcactgaccggcaaccaggccgcacaacaggtcaag
gccggactcaaagccatttacctctccggctggcaggttgctgctgatgcaaacacttcc
ggcaacacgtacccggaccagtcgctctacccggtgaactcagttcccaccgtggttcgt
cggatcaacaacgcactacttcgcgcggatcagattgaattctccgaaggcaagcagtcc
gttgaagattggctggtcccgatcgtggccgacgccgaagctggctttggcggcccgctc
aacgcttacgaactgatgaagtcaatgatccaagctggcgcttcgggcgtgcactgggaa
gatcagctcgcctcggaaaagaagtgcggtcacttgggtggcaaggtgctcattcccaac
cagcagcacgtccgcacgctcaacgcggcccggctcgcggccgacgtcgacgagcgtgac
caagagttcaccaccggcgagcgcactgccgagggtttctacaaagtacgcaacggcatt
gaaccgtgtattgcaatggccaaggcttatgccccgtacgcggatcagatgctggcttac
aactgctcaccgtcgttcaactggaagaagcatttggacgacgccacgatcgcgaagttc
cagcgggagctcggcgcaatgggcttcaagttccagttcattaccctggctggcttccac
gccctgaattactcaatgtttgacttggctcacggttacgcccgtgatggcatgagtgct
tacgtcgaattgcaagaaaaagaattcgcctccgaagaccgcggctacaccgcaaccaag
caccaacgcgaagtgggcactggctacttcgatctggtcgcggccgccctgaaccccagc
ggcagcacgctcgccttggctggctcaactgaagcccagcaattccactaa

DBGET integrated database retrieval system