KEGG   Renibacterium salmoninarum: RSal33209_0215Help
Entry
RSal33209_0215    CDS       T00641                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rsa  Renibacterium salmoninarum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RSal33209_0215
Enzymes [BR:rsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RSal33209_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
183237..184262
Genome map
AA seq 341 aa AA seqDB search
MGHMNELRIEANGNLGPIDSSRIPRYAGAATFARLPRLDQVARADVAVVGVPFDTGVSYR
PGARFGANHVRESSRLLRPYNPAQDISPFELAQVADAGDMAVNPFNINEAIEEIQHNALE
LTAPDAEGRSAKLLTLGGDHTIALPLLRAASERAGAPVALLHFDAHLDTWDTYFGAEYTH
GTPFRRAVEEGILDTEAISHVGTRGPLYGKKDLEDDKRFGFGIVTSSDVFRQGVDEVVHK
LRDRIGNRPLYVSIDIDVLDPAHAPGTGTPEAGGITSRELLEILRGLRGMNLIGADVVEV
APAYDHAEITGVAASHVAYDLVSLLADGVNRDRLKTEESSR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacatgaatgagctgcgcatcgaggcgaatggaaacctcggaccaatcgattct
tcccgtattccacgttacgccggcgcagccacttttgcgcgactgccgcgacttgaccag
gtggcccgggccgacgtcgccgtcgttggcgtgccgttcgacactggcgtctcctaccgc
ccgggcgcgcgctttggcgctaatcatgtgcgcgaatcctcgcgcttgctgcgtccttac
aatccggcgcaagacatctcaccttttgaactggcgcaagtcgctgacgccggtgatatg
gcggtcaatccgttcaatatcaacgaggcgatcgaggagatccagcacaatgcgcttgag
ctcactgcgccggatgcggaggggcgtagcgccaagctgctgacgctcggcggagatcac
acgattgccttgccgttgttgcgcgcagcctccgaacgggccggcgcaccggttgcactg
ttgcacttcgatgcgcacttggacacctgggatacctactttggtgccgaatacacgcac
ggaacgcctttccgccgcgcggtcgaagaaggaatcttggacaccgaggcaatcagccac
gttggtacccgtggcccgctttatggcaaaaaggacctggaagacgataagcgatttggc
tttggcatcgtcacttcctcggacgtcttccggcaaggcgtcgacgaagttgtgcacaaa
ttgcgggaccgaatcggcaatcggccgctgtacgtttccatcgatattgacgtgctggac
cctgcacacgcgccgggtaccggcactccggaggctggcggcattaccagccgcgagctg
ctcgagatcttgcgcggactacgtggcatgaacttgattggtgctgacgtcgttgaggtc
gcgccggcttatgatcatgcggaaatcactggcgttgcggcttcgcatgtcgcctatgac
ttggtatccctattggccgacggcgtaaatcgcgatcgtctgaagactgaagagagcagc
cgatga

DBGET integrated database retrieval system