KEGG   Renibacterium salmoninarum: RSal33209_0239Help
Entry
RSal33209_0239    CDS       T00641                                 

Definition
O-glycosyl hydrolase 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rsa  Renibacterium salmoninarum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RSal33209_0239
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RSal33209_0239
Enzymes [BR:rsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RSal33209_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(200937..202397)
Genome map
AA seq 486 aa AA seqDB search
MTSENLLREVNGVIWPGFLGSSVPDWLNDALSDGLAGVVYFRQNIESAKQLKDLSAQIRT
LNPSAIIGVDEEGGNVTRLQTEHGSQLPGAAVLGRRDELAVTEAAGTAIGRLCRQSGINL
AIAPVADVNTNPANPVIGVRSFGADTGLVARHTAAMVRGIQKTGIAACAKHFPGHGDTHT
DSHLGLPRLEFDVAQLREQHLPPFQAASEAGVEAVMTAHIVLADLGEEPATTNSSTLQML
RESGFDGVIITDALDMAAIRETVGSGAGAVKAILAGTDLLCVGNPANPRASADPEPDRTD
YLEVRDALLAAVQSGALPRERLKAAYQRNQSLATRIALATENPHSVNNSTEDPDWVDVAE
SVLWSNAPLSESLFAAKRISLRDLRGDQNLAIGAAGSFFHTAFAEYFELVEADVPDVVIA
DSLEDGSRQWRELSRLAALNPKLICLNAGLRPVQTPPAITVTAFGSSQISAQEVAGYFQK
SAVPVL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgagaatctactgcgcgaagtcaatggcgtgatctggcccggcttcttgggt
agtagtgtgcccgattggctcaatgacgcgctcagtgacggcttagcgggagtcgtatat
tttcggcaaaacatcgaatccgccaaacagctgaaggatttgtcagcccaaatccgcacg
ctcaatccgtcggcaattatcggcgtcgatgaagagggcggcaatgttacccgcttacag
accgaacacggttcgcagcttccgggtgccgcagttcttggccgacgcgacgagctagct
gtgaccgaagccgccggcacagccatcggacggctctgccggcaaagcggcattaacctg
gcgattgcgccggttgccgatgtcaataccaacccggcaaatcccgttatcggcgtccgg
tcgtttggcgcggacaccggtttagtcgcccgacacactgctgccatggttcgtgggatt
caaaaaaccggaattgccgcatgcgccaagcattttcccggccacggggatacgcacaca
gattctcaccttgggttgcctcggctggaattcgatgtggctcaactacgcgagcagcat
ctgccgccgtttcaagctgcgagcgaggccggcgtcgaggctgttatgaccgcccatatc
gtcttagccgaccttggcgaggaaccggccaccactaattcctcaacgttgcagatgctg
cgcgaaagcgggttcgacggcgtaatcatcaccgacgcactcgatatggcggcaatcaga
gaaacagtcggttccggagctggcgcggtcaaagcaatattggccggtactgacctgctc
tgcgtcggcaacccggctaatccaagagcgtcggccgaccccgagcctgatcgcaccgat
tatttggaggtccgtgatgctctgcttgccgccgtccaaagtggtgcactcccccgtgaa
cggctcaaagctgcctaccagcgcaatcaatcgctagccacccggattgccttagctacg
gaaaatccgcacagcgtcaacaattccaccgaagatccggactgggttgacgttgccgaa
agcgtgctgtggagcaatgcaccgctgtcagaatcactttttgctgccaaacgaatttct
ttgcgggatcttcgcggtgaccaaaatttggccatcggcgccgcgggtagctttttccat
accgcattcgccgagtactttgagctggtcgaagctgatgtgcccgacgtcgtaattgct
gattctttggaggatggctccagacaatggcgtgaactttctcgacttgctgcgctgaac
ccaaagttgatttgcctcaatgccggtctgcgcccagttcaaacgccgccagcgatcacg
gtgaccgccttcggttcctcccagattagcgcacaagaagtggcaggctatttccaaaaa
tcagcagtgccagtgctctaa

DBGET integrated database retrieval system