KEGG   Renibacterium salmoninarum: RSal33209_0302Help
Entry
RSal33209_0302    CDS       T00641                                 

Definition
succinate dehydrogenase cytochrome b556 subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rsa  Renibacterium salmoninarum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:rsa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rsa00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rsa00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rsa00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(254680..255156)
Genome map
AA seq 158 aa AA seqDB search
MTAIEAPRSAKATGKSGINYNRNKGSGSKFEMFAWLFMRLSGVILIVLIFGHLFVNLMVG
EGVHAIDFGFVAGKWASPFWQIWDLLMLWLAMLHGTNGVRTIINDYAEKTGTRIALKTVL
YVATVVIITLGTLVIFTFDPCVVGSDGLPLPGSFCPVP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactgctattgaagccccacgtagcgcaaaggccacgggaaagtccggaatcaattac
aaccggaataaaggctcgggctcaaagtttgagatgttcgcctggttattcatgcgtttg
tccggcgtaattttgatcgtcctcatcttcggtcacctcttcgtcaacctgatggtcggc
gaaggtgtgcacgccattgatttcggcttcgttgccggtaaatgggcaagcccgttctgg
cagatctgggatctgctgatgctttggctggcgatgctgcacggcactaacggcgtgcga
accatcatcaacgattacgcagaaaagaccggtactcgaattgccttgaagaccgtgctc
tacgtggctaccgtcgtcatcattaccctgggtaccctggtgattttcacctttgatcct
tgcgtcgttggttccgatggcttgccgctacctggcagcttctgcccagtaccttag

DBGET integrated database retrieval system