KEGG   Renibacterium salmoninarum: RSal33209_0322Help
Entry
RSal33209_0322    CDS       T00641                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00240  Pyrimidine metabolism
rsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RSal33209_0322
Enzymes [BR:rsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RSal33209_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N dCMP_cyt_deam_1 dCMP_cyt_deam_2
Motif
Other DBs
NCBI-ProteinID: ABY22078
UniProt: A9WME3
Position
268089..269105
Genome map
AA seq 338 aa AA seqDB search
MNSSIDWPELAAQATAAMRRAYVPYSKFPVGAAALTKDGRIVVGCNVENASYGLTLCAEC
TLVGALQMSGGGKIAAFYRVDGEGKVLMPCGRCRQLLYEHRGSDMQLMTVSGIKTMDQVL
PDAFGPENLFRIASELMTESFDAVDVIRTKLDHGILSQAQIAWTIDAYTRGVIAEEQMAA
LNMAILLNGMNREEIAQWTAAMIASGERMEFSSLRAVNGGPVNAQGSKPTSDKHSTGGVG
DKITLPLAPLVAVFGVAVPKLSGRGLGHTGGTLDKLEAIPGWRAALSNEEMMQQLQDVGA
VICATGSGLAPADKKIYALRDVTGTVEAIPLIASSIIE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagcagcatcgattggcccgaacttgccgcccaggctactgccgcgatgcggcga
gcctatgtgccctattcgaagttcccggtgggtgcggcagcactcaccaaggacggtcga
attgttgtcggttgcaatgtggagaacgcctcctatggactcaccttgtgcgccgagtgc
accttggttggtgcgctacagatgagcggtggcggcaagatcgctgccttttatcgtgta
gacggcgagggcaaagtgctgatgccctgcggccgctgccggcagctactttacgaacat
cgaggtagcgatatgcagctgatgacggtgtccggaattaaaaccatggaccaagttttg
ccagatgctttcggtccggaaaatctattcagaatagcgagtgaactcatgactgaatcc
tttgatgccgttgatgtgatccgcaccaagcttgatcacggaatcttgagccaagcgcaa
attgcttggactattgacgcttacacccgaggtgtcatcgcggaagagcagatggccgct
ttgaacatggcgatcttgctcaatggcatgaaccgggaagaaatcgcacaatggactgct
gcgatgatcgcctccggcgagcgaatggaattttctagtctcagggcagtcaacggcggc
ccggttaacgctcagggcagcaagccgacgtcggacaagcactcgaccggcggtgtgggg
gacaagatcaccttgccgctggctccgctggtggcagtctttggcgttgcggtgccgaag
ctttctggccgtggacttggtcacactggcggcactttggacaagctcgaagcgattcct
ggctggcgggctgcgctctcaaatgaggagatgatgcagcaacttcaagacgtcggcgca
gtaatttgtgccacaggttctggcttggcgccggctgataaaaagatctatgccttgcgt
gatgttacgggaaccgttgaggctatcccgctgattgcttcctcaatcattgagtaa

DBGET integrated database retrieval system