KEGG   Renibacterium salmoninarum: RSal33209_0352Help
Entry
RSal33209_0352    CDS       T00641                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00020  Citrate cycle (TCA cycle)
rsa00640  Propanoate metabolism
rsa00660  C5-Branched dibasic acid metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01130  Biosynthesis of antibiotics
rsa01200  Carbon metabolism
Module
rsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSal33209_0352
   00640 Propanoate metabolism
    RSal33209_0352
   00660 C5-Branched dibasic acid metabolism
    RSal33209_0352
Enzymes [BR:rsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RSal33209_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ComX DUF2559
Motif
Other DBs
NCBI-ProteinID: ABY22107
UniProt: A9WKU9
Position
292523..293692
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQARDMFEAHGVPVLAGIVANTAEEAKAAAEKIGGVTVVKAQVKVGGRGKAGGVK
VAKTADEAFEYAGNILGMDIKGHTVHKVMIAQGADIAEEYYFSVLLDRANRNYLAMCSVE
GGVEIEVLAVERPEALARIAVDPAVGIDQAKAEEIVDAAGFAADVLDGVIETIKKLWDVF
QKEDATLVEVNPLVKTGDGRILALDGKVTLDANADFRHPDHEALEDKDSADPLEAKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGESHGNVKPANFLDIGGGASAEVMAAGLD
VILNDAQVKSVFVNVFGGITACDAVANGIVKALEILGTSANKPLVVRLDGNNVEEGRRIL
TEANHPLVTQAATMDEGADKAAELAHAAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtttgaataccaggcgcgcgacatgtttgaagcacacggcgttcccgtgctt
gcaggcattgtcgccaacaccgcagaagaagccaaggccgcagccgagaaaatcggtggc
gtgaccgttgtcaaagcacaggtaaaggtgggcggccgcggtaaggccggtggtgttaaa
gtcgccaagaccgcggatgaggcgttcgaatacgccggcaacatcctcgggatggatatc
aagggccataccgtgcacaaagtcatgatcgcccagggtgcagatattgctgaggaatac
tacttctcggtgctgctcgaccgagcgaaccgcaactacctggccatgtgctcggttgaa
ggcggcgtggagatcgaagttctcgcggttgaacgccccgaggcacttgcacgcattgcc
gttgaccccgctgtgggcatcgaccaggcgaaggctgaagagatcgtcgacgctgctggc
tttgccgcagacgtgcttgatggcgtgatcgaaaccatcaagaagctttgggatgttttc
cagaaggaagacgcgactttggtcgaggtcaatccactggtgaagaccggcgacggtcgc
atccttgcccttgacggcaaggtcaccctggatgctaacgctgacttccgtcaccctgat
cacgaagctcttgaggacaaagactcggccgacccgcttgaggctaaagccaaagagaac
gacctcaactacgtcaagctcgacggcgaagttggcattatcggtaatggtgcaggtttg
gtgatgtccactttggacgtcgtcgcttacgccggcgagagccacggcaacgtgaagcca
gccaacttcctggacatcggtggtggagcttccgccgaggtgatggcagccggtctggac
gtcattctcaacgacgcgcaggtcaagagcgttttcgtgaacgtcttcggcggcatcact
gcgtgtgacgcagtcgcaaacggaatcgtgaaggcgctggaaatcttgggcacgtcggcg
aacaagccgctcgtggtccgtctcgacggtaacaacgtcgaagaaggccgccgcattctg
accgaagccaatcacccgctggtgactcaggccgccaccatggacgagggcgccgataag
gctgccgagctcgctcacgctgcgaagtaa

DBGET integrated database retrieval system