KEGG   Renibacterium salmoninarum: RSal33209_0404Help
Entry
RSal33209_0404    CDS       T00641                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00010  Glycolysis / Gluconeogenesis
rsa00260  Glycine, serine and threonine metabolism
rsa00680  Methane metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01130  Biosynthesis of antibiotics
rsa01200  Carbon metabolism
rsa01230  Biosynthesis of amino acids
Module
rsa_M00002  Glycolysis, core module involving three-carbon compounds
rsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSal33209_0404
  Energy metabolism
   00680 Methane metabolism
    RSal33209_0404
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSal33209_0404
Enzymes [BR:rsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RSal33209_0404
Membrane trafficking [BR:rsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    RSal33209_0404
Exosome [BR:rsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RSal33209_0404
  Exosomal proteins of melanoma cells
   RSal33209_0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABY22158
UniProt: A9WLX7
Position
334992..335753
Genome map
AA seq 253 aa AA seqDB search
MDRLLDMTYTLILLRHGHSEWNAKNLFTGWVDVDLNDQGRAEAVRGGQLLVENDLLPDVL
YTSRQKRAINTANLTLAEADRGWIDVKRSWRLNERHYGALQGKDKAQTLAEFGEAQFMEW
RRSYDVPPPPLPDDSEFSQVGDPRYADLGDAIPRTECLKDVLERLLSYWESDIKADLCAG
KTVLVTAHGNSLRSLVKHLDGISDEAIAGLNIPTGIPLVYELDENFAPITAGGRYLDPAA
AAAIQAVANQGKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttggatagacttctagacatgacttatacgctgattttgctgcgccacggccatagcgaa
tggaacgccaagaatctcttcaccggttgggtcgacgtcgatttgaacgaccaaggccga
gctgaggcagtgcgcggcggccagctgctggtggaaaacgatttgctacctgacgttttg
tatacgtcacggcaaaaacgtgccatcaataccgccaatttgaccctggccgaagccgat
cgtggctggattgatgtcaagcgttcttggcggctgaatgagcgccattacggtgctctg
cagggcaaagataaagctcaaacgctcgcggaattcggcgaggcccagtttatggaatgg
cgccgcagctacgatgttccgccgccgccgctgcctgatgactccgagttctcccaggtg
ggggatccacgttacgccgatctaggggacgccattccgcgcacggaatgcctcaaagat
gttttggagcgactgctgtcgtactgggaatccgatatcaaagcggatctgtgcgccggg
aagacggtcctggtgaccgcgcacggtaattcgttgcgctcgttggtcaaacaccttgac
gggatttccgacgaggccattgctggcctgaatatccctaccggtatcccgttagtttac
gaactggacgagaacttcgcaccgattactgccggtggccgctatcttgacccggctgct
gctgctgcgattcaagcagtagcgaatcaaggcaaaaaataa

DBGET integrated database retrieval system