KEGG   Renibacterium salmoninarum: RSal33209_0404Help
Entry
RSal33209_0404    CDS       T00641                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rsa  Renibacterium salmoninarum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSal33209_0404 (gpmA)
   01230 Biosynthesis of amino acids
    RSal33209_0404 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSal33209_0404 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RSal33209_0404 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSal33209_0404 (gpmA)
Enzymes [BR:rsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RSal33209_0404 (gpmA)
Exosome [BR:rsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RSal33209_0404 (gpmA)
  Exosomal proteins of melanoma cells
   RSal33209_0404 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334992..335753
Genome map
AA seq 253 aa AA seqDB search
MDRLLDMTYTLILLRHGHSEWNAKNLFTGWVDVDLNDQGRAEAVRGGQLLVENDLLPDVL
YTSRQKRAINTANLTLAEADRGWIDVKRSWRLNERHYGALQGKDKAQTLAEFGEAQFMEW
RRSYDVPPPPLPDDSEFSQVGDPRYADLGDAIPRTECLKDVLERLLSYWESDIKADLCAG
KTVLVTAHGNSLRSLVKHLDGISDEAIAGLNIPTGIPLVYELDENFAPITAGGRYLDPAA
AAAIQAVANQGKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttggatagacttctagacatgacttatacgctgattttgctgcgccacggccatagcgaa
tggaacgccaagaatctcttcaccggttgggtcgacgtcgatttgaacgaccaaggccga
gctgaggcagtgcgcggcggccagctgctggtggaaaacgatttgctacctgacgttttg
tatacgtcacggcaaaaacgtgccatcaataccgccaatttgaccctggccgaagccgat
cgtggctggattgatgtcaagcgttcttggcggctgaatgagcgccattacggtgctctg
cagggcaaagataaagctcaaacgctcgcggaattcggcgaggcccagtttatggaatgg
cgccgcagctacgatgttccgccgccgccgctgcctgatgactccgagttctcccaggtg
ggggatccacgttacgccgatctaggggacgccattccgcgcacggaatgcctcaaagat
gttttggagcgactgctgtcgtactgggaatccgatatcaaagcggatctgtgcgccggg
aagacggtcctggtgaccgcgcacggtaattcgttgcgctcgttggtcaaacaccttgac
gggatttccgacgaggccattgctggcctgaatatccctaccggtatcccgttagtttac
gaactggacgagaacttcgcaccgattactgccggtggccgctatcttgacccggctgct
gctgctgcgattcaagcagtagcgaatcaaggcaaaaaataa

DBGET integrated database retrieval system