KEGG   Renibacterium salmoninarum: RSal33209_0414Help
Entry
RSal33209_0414    CDS       T00641                                 

Definition
guanyl-specific ribonuclease (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rsa  Renibacterium salmoninarum
Brite
Enzymes [BR:rsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     RSal33209_0414
Transfer RNA biogenesis [BR:rsa03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    RSal33209_0414
 Prokaryotic Type
    RSal33209_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
346271..346801
Genome map
AA seq 176 aa AA seqDB search
MTPKQAQRAQTTQRKKLAGLVAGLIALLLVVGGIFLFNKLTGHDDGAAAASSSTKNSAKA
STSAKSSTKPTAASNAAANNPSKLPAVKASALPQEAQQTLALIAKGGPYPYDRDGINFGN
FEGVLPKKSSGYYKEYTVKTPGSSDRGARRVIVGDGGEKYYTDDHYASFSFIQENQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgaagcaagcgcagcgcgctcaaacgacccagcgcaaaaagcttgccggtttg
gtggccggtctcatcgccctgctcctagtggtgggcggtatttttcttttcaataaactg
accgggcacgacgacggcgctgcagccgcgtctagctcgaccaaaaactcggcaaaagct
tcgacaagtgctaaaagctcaactaagccaacagccgcctcaaacgccgcagcgaacaac
ccttcgaaactccccgcagtaaaagcctctgcacttccgcaagaagcacagcagacgtta
gctctcatcgcgaagggcggcccctacccgtatgaccgggatggcatcaacttcggaaat
ttcgaaggcgtattgccgaagaaatccagcggttactacaaggaatacacggtgaaaaca
ccgggctcgtcagatcgtggtgcccgacgggtaattgtcggtgacggtggggaaaagtac
tacacggatgaccactacgcgagcttttcgttcattcaggagaaccaatga

DBGET integrated database retrieval system