KEGG   Renibacterium salmoninarum: RSal33209_0428Help
Entry
RSal33209_0428    CDS       T00641                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rsa  Renibacterium salmoninarum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RSal33209_0428
Enzymes [BR:rsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RSal33209_0428
Exosome [BR:rsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSal33209_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
359240..362965
Genome map
AA seq 1241 aa AA seqDB search
MANPAPTIPDLLRDWLPPRRWYPVKNSSVESGTSGESNGAGLYRVGGFRLTPPADAKNSG
VGSLEVHLVSVRTSPSTEREGTEPEGTVTVLQIPLRCRTEALAGAETSLIGITQHPELGE
CWVYDGVYDPVFLAAWLDLLHLQSTTEDGALSSYSSAQFRSVHELGKTTRIRVISSEQSN
SSVVINNRVLPLILKFFRVLNSGINPDIEVGQALTEAGCLDTPALHGWVQGSWDSAPRTG
QRVVGSLCVLHELVPKAQDGWDLAVASAKASSNSPGKPAFTVEAEQLGLVTARLHATMRS
ALGRTSLHAQARGEFLAELEARIRWAWSQAGPAVGPFQHLVGKVLDGLVNVEGPLELQRI
HGDLHLGQVIRTLADGQPAKWFVLDFEGEPLRAVAERSRPDVPLRDVVGLLRSIDYASAT
ANGEPENSAWAEQTSAAFIRGYESLDADGNRISTTSPLFLALCLDKALYEVVYELRNRPD
WLQVPVAAVRRLLSSLETDEGETAMNSANAAEPHQPISVSEELLRRVSAGNYHAPHEVLG
VHLDEQGWVTIRTLRDLVQAVAVVTSSGTVEMQHEYDGIWVAVLQPEQPGHAPDYRISAS
YADGNVETFDDPYRFLPTLGDVDLHLIGEGRHEELWAALGSHPRSYPSQLGAVNGVSFAV
WAPNAQAVRVKADFNNWDGRGYAMRSLGSSGVWEIFIPDAKPGNSYKFEILSRAGTWQDK
ADPMAFGTEVPPLTASKVVESNYKFTDTEWMAQRSNVDPHNSPMSVYEVHLGSWRPGLSY
LELSRELVEYAQWMGFTHVEFMPVAEHPFGGSWGYQVTSYFAPTSRFGDPKEFKHLVDAL
HGAGIGVIVDWVPAHFPKDEWALAKFDGEPLYEHSDPQLGEHPDWGTLIFDFGRSEVRNF
LTANALFWFEEFHVDGLRVDAVASMLYLDYSREAGEWKPNRLGGRENLEAISFLQEVNAT
AYKRSGGVVMIAEESTAFPGVTAPTDQNGLGFGLKWNMGWMHDSLAYIAEDPINRKWHHG
TATFSLVYAFTENFLLPISHDEVVHGKGSMLRKMPGDRWQQLANLWAFLAWQWAHPGKQL
IFMGTEFGQEAEWSEQHGLDWWLADMAPQRGVQLLVRQLNEVYRLAPARWQQDNSHSGFE
WINATDADRNVISFIRRDLQGNPLVCVVNFSGAPHHDYRLGLPSAGQWRELLNTDAEEYG
GSGVGRVEPAAIGHAVLSSEFGPGRITPGHTSVSDSKTTFR
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccctgccccgacgattcccgatctgctgcgagactggctgcctccccggcgt
tggtatccggtgaagaacagttcggttgagtccggaacatccggcgaatcgaacggggca
ggactgtatcgagttggtggatttcgactcaccccacccgcggatgccaagaattccggc
gtcggcagccttgaagtgcacttagtctcagtgcggacatccccgtcgaccgagcgcgaa
ggcacagagccagaaggcacagtcactgttctgcaaatcccgttgcgttgccggaccgaa
gctctggccggcgcggaaacctcattgattggaattacgcagcaccccgagcttggcgaa
tgttgggtttatgacggagtttacgatccagtgtttctcgcggcctggctggatcttttg
catctacaaagtacaaccgaagatggtgcgctgagctcgtattcttccgcgcagttcaga
tccgtccatgaacttggcaaaacaactcgaattcgggtgatcagttcggagcagtcaaat
agttccgtggtgatcaacaatcgagtgttgcccttgatcttgaagtttttccgcgtgtta
aacagcggtatcaatccggatatagaggttggtcaagcgctcacggaggcgggctgctta
gacactcctgccttgcacggctgggtccaaggcagctgggattctgcgccacgcaccggt
caaagagtagtgggcagtttatgtgtgctgcacgaattggtgccaaaagcacaggatggt
tgggatctggccgttgccagcgcaaaggccagcagtaacagcccgggcaagccggccttt
accgttgaagctgaacaacttggcctggtcacggcgcgactacatgccacgatgcgttcg
gctttggggcgcacctcgcttcatgctcaagctcggggcgaatttttggctgagctcgaa
gctcggattcggtgggcttggtcgcaagctggcccagctgtcggtcccttccagcaccta
gttggcaaggtcttggacggtctagtaaatgtcgaaggtccgttggagttacaacgaatt
catggcgacctccatctgggacaggtgattagaaccttggcagatggccagccggcgaag
tggtttgtgctggattttgaaggcgagccactgcgagccgtggctgaacgatcccgacca
gatgtgccgctccgcgacgtcgtcggacttttgcgttcaatcgattacgcctcagcaact
gccaatggcgaaccagagaattcagcttgggcggagcagactagtgccgcatttatccgc
ggatacgagtcgttggacgcggacggcaatcgaatcagcactacctcaccgctctttctg
gcattgtgcctagataaagcgttatacgaggtggtttacgaacttcgaaaccgcccggac
tggcttcaagtaccggttgcagcggtgcggagattattgagctcactggaaaccgacgaa
ggcgagacagccatgaattccgcgaacgccgccgaaccgcaccagccgatctcagtgagc
gaagaactgctccggcgagtctcagcaggaaattatcatgcgccacacgaggttcttggt
gtgcacctcgacgaacagggctgggtgacaattcgcacgctgcgcgacctggtccaagct
gttgcggtagtgaccagttctggcaccgtggagatgcagcacgaatatgacggaatctgg
gttgccgtgcttcagcccgaacagcccggccatgcccctgactaccggatttcggcaagc
tacgctgatggaaacgtcgaaacttttgatgacccgtaccgctttttgccaacacttggc
gacgtcgaccttcacctgattggcgaaggcaggcacgaggaattgtgggctgctctgggc
tctcacccgcggagctatccttcgcaacttggtgcggtgaatggcgtaagtttcgcggtc
tgggcgccaaacgcccaagccgtgcgcgtgaaagcggatttcaataactgggatggccgg
ggctacgcgatgcgatccttaggttcctcaggggtatgggaaattttcattccagatgcc
aaaccgggtaacagctataaattcgaaatactctcgcgtgcaggcacttggcaagacaaa
gcggatccgatggcatttggcaccgaagttccgcctttgacggcgtcaaaagtcgtcgaa
tccaactacaagttcactgataccgagtggatggcgcagcgcagcaacgttgatccgcat
aattcaccgatgagtgtttatgaggtgcatctgggttcttggcggccggggttgagctat
ctagagctatcgcgagaattggtcgaatatgcgcagtggatgggattcacgcacgtcgag
ttcatgccggttgccgaacatccctttggcggctcctggggctatcaagttacttcgtat
tttgccccaacctcccggtttggtgatccaaaggagttcaagcacttagttgatgcgctg
cacggcgctggcattggcgtcatcgtagattgggtgccagcgcacttccccaaagatgaa
tgggcgttggcaaaattcgatggcgaaccgctttatgaacattcggacccgcagctgggc
gagcatccggactggggcactctgattttcgatttcggccgctctgaggtgcggaacttc
ttgaccgcaaatgccttgttctggtttgaagaattccatgtcgatgggttacgtgtggat
gccgtcgcttcgatgctttaccttgattactcacgtgaagccggtgaatggaagcccaat
cgcctcggtgggcgggagaatttagaggcaatttctttcctgcaagaagtcaacgccacc
gcgtacaaacgttctggcggggtagtgatgatcgcggaagaatctactgcattccccggc
gttacggcaccaacggatcagaacggtctagggttcggtctgaaatggaatatgggttgg
atgcatgattctcttgcctacattgctgaagatccgatcaaccggaagtggcatcacgga
acggcgaccttttctttggtctacgccttcaccgagaatttcttgctaccaataagtcac
gatgaagtggtgcatggcaagggttccatgctgcgaaagatgccgggggaccgctggcaa
caactggccaacctgtgggctttccttgcttggcagtgggcgcatccgggcaaacagcta
attttcatgggcaccgagttcggccaagaagctgagtggagcgaacagcacggactggat
tggtggctggcggacatggcaccgcagcgcggtgtgcaacttctggtgcgccagctcaac
gaggtttatcgcttggcgcccgcgcgttggcagcaggacaattcccatagcggatttgaa
tggattaacgcgacggacgcagatcgcaatgttatttccttcattcgtcgggacctgcag
ggcaatccgctagtttgcgtggtgaatttctccggagctccgcaccatgactaccgactt
gggctgccttctgctgggcagtggcgcgaattgttgaacaccgatgctgaagagtacggg
ggatccggcgtcggccgtgttgagcctgccgccattgggcacgctgtacttagctccgaa
tttggccccggccgaataaccccaggtcatacgtccgtttcggatagcaagacgacattt
agatag

DBGET integrated database retrieval system