KEGG   Renibacterium salmoninarum: RSal33209_0570Help
Entry
RSal33209_0570    CDS       T00641                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00010  Glycolysis / Gluconeogenesis
rsa00020  Citrate cycle (TCA cycle)
rsa00620  Pyruvate metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01130  Biosynthesis of antibiotics
rsa01200  Carbon metabolism
Module
rsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSal33209_0570
   00020 Citrate cycle (TCA cycle)
    RSal33209_0570
   00620 Pyruvate metabolism
    RSal33209_0570
Enzymes [BR:rsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RSal33209_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_D23 Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABY22319
UniProt: A9WLC0
Position
476699..478036
Genome map
AA seq 445 aa AA seqDB search
MGESMNSFKLPDVGEGLTEAEIVSWKVKVGDVVAINDGLVEIETVKSLVELPSPYAGIVS
ALLVAEGQTVDVGTEIITIGAAGAGPLLAHPSVDIAPENIIAETQKRTLPSAEESDEPQP
GPLVGTGPEADSVHRRARKRDVSLSTAPLAAELTRPTVAEVVTRPLATPPVRKAAQDSGI
DLSLVRASGLRGEITRKDLQDYQQQTEPIPVVGSAAGLIERIPVKGVRKATAEAMVRSAF
SAPHVSIFVDVDATRTMEFVKRLKASSDFDGVKISPLLIVAKAVIWAAARNPSANAAWAD
QEILLKKFINLGIAAATPRGLVVPNIKNAQELSLKELAIALNTLAETARAGKTQPAQMQD
GTLTITNIGALGLDTGTPIINPGEVAIVAFGTIKQKPWVVDGQVVPRWITTLGGSFDHRV
VDGDVAARFLGDVAAILEEPALLLD
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggggaatccatgaacagcttcaaattgcccgatgttggcgaaggccttaccgaggcg
gaaattgtctcctggaaagtcaaagttggcgatgtagttgcgatcaacgacggcctagtt
gaaattgagactgtaaaatccctagtggaactgccttcgccgtatgcggggatcgtgagt
gcgcttctggtcgcggagggtcagaccgtcgacgtcggaaccgaaatcattacgattggc
gccgcgggagctggccccttgttggctcatccgtccgtggatattgcgccggaaaacatt
attgcggagacacagaaacgtaccctgccttccgccgaggaatcagatgagcctcaaccc
ggtcctttggttggcaccggaccggaagcggattcagtgcaccgccgagcgcgaaagcgc
gatgtttcgcttagtactgcaccgttggcagcagaacttactcgaccgacagtggccgaa
gtggtgacgcgtccactggcaaccccgccggtgcgcaaggcagcgcaagactccggaatc
gacctgtccctggtacgagcatctgggcttcggggcgagatcaccagaaaagatctgcag
gactaccagcagcaaactgaaccaattccagtcgtgggctccgctgctgggttgatcgag
cgcattccggttaaaggagtccgcaaagcaacggccgaagccatggtgcgcagcgccttc
agtgctccgcatgtgagcatattcgttgacgtcgacgccactcgaacaatggagttcgtc
aaacggctcaaggcgagtagcgacttcgacggcgtcaaaatatcaccactgctgattgtc
gcgaaagcagtgatttgggctgctgcgcgcaacccaagcgcgaatgcggcctgggctgat
caggagattttgctgaagaagttcattaatttgggtattgctgcggcaacgccacgtggc
ctagtggtgccgaatatcaagaatgcccaggagctaagtctcaaagagctagcaattgcc
ttgaacacgctggctgagaccgcgcgtgccgggaaaactcaacctgcgcagatgcaagat
ggcacactgaccatcaccaacattggtgctttgggattggacaccggcaccccgattatc
aaccccggcgaagtagcaattgttgcttttggcaccatcaagcagaagccgtgggttgtc
gatgggcaagtagtgccgcgttggatcaccacgctaggtggctccttcgatcatcgcgta
gttgacggcgatgttgctgcgcggttccttggcgatgttgctgcgattcttgaagaacca
gcgctgctgctggattga

DBGET integrated database retrieval system