KEGG   Renibacterium salmoninarum: RSal33209_0894Help
Entry
RSal33209_0894    CDS       T00641                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsa  Renibacterium salmoninarum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rsa01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rsa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756838..757875
Genome map
AA seq 345 aa AA seqDB search
MEEQMRHRNTESKTVTKPGFRPAKAESAVDLVSHAVDAPEQTGPRPIIHGPRTLTAQLSV
YAGVLLPLIALIAAIPLLWGHGLDWVDVGLALVFYLISGLGVTIGFHRYFTHGSFKANRT
LRAALAIAGSLSVQGSIITWVADHRRHHAFSDTDGDPHSPWAFGTSPWALTKGFWHAHMG
WLFERDVTNRSRFAPDLLKDPMIVQIDKLFPLWVAITLFLPATLGGIISQSWWGFLSAFF
WAGLVRVAVLHHVTWSVNSICHMIGERPYASRDKAANFWPLAIVSFGESWHNSHHADPTC
ARHGVRRGQIDISARTIWIFEKFGWATNIKWPNAERFAKLSIKER
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggaggaacaaatgcgccatcgaaacactgagtcgaagacggtgactaagcccggcttt
cgaccagccaaagcagagtcagcagttgatttggttagccatgcggtcgatgcgccagag
cagaccgggccgcggccgattattcatggcccgcgtaccctcacagcccaactgagtgtt
tatgccggagtcttgttaccgctcatcgccttgatcgcggccatcccgctgttatggggc
catgggctggactgggtcgacgtcggcctggcgctggtcttttatctgatcagcggattg
ggcgtgacgatcggcttccatcgctatttcacgcatggctcctttaaagccaaccggaca
ctccgggcggcgctcgcgatcgccggctcgctctcggtgcaaggctcgattattacctgg
gttgcggatcaccgtcgccatcatgccttttcagataccgacggcgatccgcattcgccg
tgggcttttggcacctcgccgtgggctttgactaagggcttctggcatgcgcatatgggc
tggctttttgagcgagatgtgactaaccgcagccggtttgccccggacctgttgaaggat
ccgatgatagttcagatcgacaagcttttcccgttgtgggttgccataacgctgttctta
cccgcgactctaggtgggattatcagccagagctggtgggggttcttgagcgcgttcttt
tgggctggtttggtacgtgttgcagtgctgcaccacgtcacgtggtcggtgaactcgatt
tgccacatgatcggcgagcggccgtacgcatcgcgagacaaagcggcgaatttctggccg
ttagcgatcgtctcgttcggtgagtcatggcataactcgcaccatgcggatccaacctgc
gccaggcacggcgtccggcgagggcagattgatatttctgccagaaccatctggatcttc
gagaagttcggttgggcgactaatatcaagtggcctaacgccgaaagattcgccaaattg
agcattaaggaacgttag

DBGET integrated database retrieval system