KEGG   Renibacterium salmoninarum: RSal33209_0894Help
Entry
RSal33209_0894    CDS       T00641                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsa  Renibacterium salmoninarum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RSal33209_0894
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RSal33209_0894
Enzymes [BR:rsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RSal33209_0894
Lipid biosynthesis proteins [BR:rsa01004]
 Desaturase
  First
   RSal33209_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756838..757875
Genome map
AA seq 345 aa AA seqDB search
MEEQMRHRNTESKTVTKPGFRPAKAESAVDLVSHAVDAPEQTGPRPIIHGPRTLTAQLSV
YAGVLLPLIALIAAIPLLWGHGLDWVDVGLALVFYLISGLGVTIGFHRYFTHGSFKANRT
LRAALAIAGSLSVQGSIITWVADHRRHHAFSDTDGDPHSPWAFGTSPWALTKGFWHAHMG
WLFERDVTNRSRFAPDLLKDPMIVQIDKLFPLWVAITLFLPATLGGIISQSWWGFLSAFF
WAGLVRVAVLHHVTWSVNSICHMIGERPYASRDKAANFWPLAIVSFGESWHNSHHADPTC
ARHGVRRGQIDISARTIWIFEKFGWATNIKWPNAERFAKLSIKER
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggaggaacaaatgcgccatcgaaacactgagtcgaagacggtgactaagcccggcttt
cgaccagccaaagcagagtcagcagttgatttggttagccatgcggtcgatgcgccagag
cagaccgggccgcggccgattattcatggcccgcgtaccctcacagcccaactgagtgtt
tatgccggagtcttgttaccgctcatcgccttgatcgcggccatcccgctgttatggggc
catgggctggactgggtcgacgtcggcctggcgctggtcttttatctgatcagcggattg
ggcgtgacgatcggcttccatcgctatttcacgcatggctcctttaaagccaaccggaca
ctccgggcggcgctcgcgatcgccggctcgctctcggtgcaaggctcgattattacctgg
gttgcggatcaccgtcgccatcatgccttttcagataccgacggcgatccgcattcgccg
tgggcttttggcacctcgccgtgggctttgactaagggcttctggcatgcgcatatgggc
tggctttttgagcgagatgtgactaaccgcagccggtttgccccggacctgttgaaggat
ccgatgatagttcagatcgacaagcttttcccgttgtgggttgccataacgctgttctta
cccgcgactctaggtgggattatcagccagagctggtgggggttcttgagcgcgttcttt
tgggctggtttggtacgtgttgcagtgctgcaccacgtcacgtggtcggtgaactcgatt
tgccacatgatcggcgagcggccgtacgcatcgcgagacaaagcggcgaatttctggccg
ttagcgatcgtctcgttcggtgagtcatggcataactcgcaccatgcggatccaacctgc
gccaggcacggcgtccggcgagggcagattgatatttctgccagaaccatctggatcttc
gagaagttcggttgggcgactaatatcaagtggcctaacgccgaaagattcgccaaattg
agcattaaggaacgttag

DBGET integrated database retrieval system