KEGG   Renibacterium salmoninarum: RSal33209_1331Help
Entry
RSal33209_1331    CDS       T00641                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rsa  Renibacterium salmoninarum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSal33209_1331
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSal33209_1331
   00052 Galactose metabolism
    RSal33209_1331
   00500 Starch and sucrose metabolism
    RSal33209_1331
   00520 Amino sugar and nucleotide sugar metabolism
    RSal33209_1331
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSal33209_1331
   00524 Butirosin and neomycin biosynthesis
    RSal33209_1331
Enzymes [BR:rsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RSal33209_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1138201..1139169
Genome map
AA seq 322 aa AA seqDB search
MGKPAAVLAFDVGGTDTKAGLVLAAEAGQIPQIIDIRRFPTALNAEQPGETLVEFLAGLM
ESYQADHPEHQIQAVGVTVPGLVDEVEGIGVYAANLGWKNFGFRAALELRMQVPVAFGHD
VGTAGDAEVALGAAQHALNAMILIVGTWIAAALYVDGGRLNAGGYAGEVGHALAPAPGGG
LGIVEANGSAGSIARRYGARKHGFEGGAREVLALAKAGDALAQQTWNEAIDTIAFSIAQA
VAMIGTNKVVLGGGLAEAGDDLLVPLAARIDALLTFQPRPELVKAALGQNAGLIGSALKA
IERRDEQLNDEADLRRKTVQHR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaccagcggccgtgctggccttcgacgtcggcggaactgatactaaagctggc
ctagtcttggctgccgaagccgggcagataccgcaaatcatcgatatcaggagatttcct
actgcgctaaacgcagagcagccaggggagactttggtggaatttctggcgggtctaatg
gagagctatcaagccgaccacccagagcatcaaattcaggcggttggcgtcactgtgccg
gggctggttgatgaagtcgaaggcattggggtttatgcggcaaacctgggttggaagaac
tttggtttcagagcagcgctcgagctacggatgcaggtgccggtagcttttgggcacgac
gtcggaacagctggcgacgccgaagtcgctttgggtgccgctcaacacgcactcaacgcg
atgattttgattgttggtacctggatcgctgcggcgctttacgtcgatggaggccggctc
aacgcgggtgggtacgctggcgaggttggccatgcactggcaccagcgccagggggcgga
ctcggcattgtcgaagccaacggttccgccggcagcattgctcgacggtacggtgctcga
aagcatggcttcgaaggcggtgcgcgagaggtgcttgcgcttgctaaagctggcgacgcg
ctcgcccagcaaacctggaacgaagccatagacacgatagcgttttcgatcgcccaggcg
gtcgctatgatcggcaccaataaagtcgtgctgggtggcggccttgctgaagccggtgat
gacttgctcgttccgctggctgcccgcatcgatgcgctgttgacttttcaaccgcgcccc
gagctggtgaaagctgcgctgggtcagaatgcgggcctgattggttcggcgctcaaggca
atcgagcgccgagatgagcaattgaacgatgaagccgatcttcgcagaaagaccgtgcag
cacagatga

DBGET integrated database retrieval system