KEGG   Renibacterium salmoninarum: RSal33209_1362Help
Entry
RSal33209_1362    CDS       T00641                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rsa  Renibacterium salmoninarum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rsa00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rsa00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1161920..1162903
Genome map
AA seq 327 aa AA seqDB search
MVSSPVGGPDGNTLAALNTMNVGNVFLKGRGYGGTQAVAAVVGQLNALVSPATTGGVKQF
IATDQKGGLVQIMNGPGFSKIPSAIDQAALGPFQIKADATIWGQQLAAAGVNVNFGPVLD
TVPSAAFAPQNAPIGYFGREYGFTPQDVSARGVAAALGFAAGGVAPTVKYFPGLGRVSAN
TDVASNVTDETTVRQDAFLQPFRDPVASGVRWVMVSNAYYPAIDPQNIAPFSPVVMKEML
RGDLGFNGIIVSDDICDAVHLSPFAVANRGANFIAAGGSMALCTNQALLPAMYQGILARA
TADPVFAASVDAAALKVLEIKAESGLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtttcttctccggtgggtggcccagacggtaatactttggctgcattgaacacgatg
aatgttggcaatgtctttttgaagggtcgcggttacggtggcacccaggcggttgccgcc
gtcgtcgggcaactgaatgccttggtttcgccggctacgacgggcggagtcaagcagttt
attgcgaccgatcaaaaaggcggtttagtccagatcatgaatggtccgggcttttcaaaa
attccttcagctattgatcaagctgccttagggccgtttcagatcaaggctgatgcgacc
atctggggccaacagcttgcggccgccggtgtgaacgtgaactttggtccggtcttggac
accgtgccgtcagctgcttttgccccgcagaatgcccccatcggctacttcggtcgcgaa
tacggctttacaccgcaagacgtttccgccaggggagttgcggcggcgcttggatttgct
gctggtggagttgcgccaacggtgaagtattttccgggacttggccgggtgagtgcgaat
actgacgtggcaagtaacgtcaccgatgagactaccgtgcgtcaagacgcgtttctgcaa
ccattccgagatcctgtcgcgtcaggcgtgcgttgggtgatggtatctaatgcctattac
ccggcgatcgatccgcagaacatcgcaccgttttcgcctgtcgtcatgaaagaaatgttg
cgcggagatttgggcttcaacggaatcatcgtttccgacgacatttgtgatgcggtgcac
ctgtcgccgttcgcggtggcaaatcgtggcgcaaattttatcgccgctggtggcagcatg
gctctttgcacaaaccaagccttattgcctgctatgtatcagggaatattggccagggcg
acggcggatccagtgtttgctgcttctgttgatgcagccgctttgaaagttttggaaata
aaagccgagtctgggctgctgtag

DBGET integrated database retrieval system