KEGG   Renibacterium salmoninarum: RSal33209_1430Help
Entry
RSal33209_1430    CDS       T00641                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsa  Renibacterium salmoninarum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSal33209_1430
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSal33209_1430
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RSal33209_1430
Enzymes [BR:rsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RSal33209_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1220169..1221257
Genome map
AA seq 362 aa AA seqDB search
MAQQWRGVIREYADRLPVTESTKVITLGEGGTPLVPARALYELTGCNVYVKVEGMNPTGS
FKDRGMTMAITAAVEAGAKAVVCASTGNTSASAAAYATAAGLTCAVLVPAGKIAMGKLSQ
AVAHGATLLQVDGNFDNCLEVARKLADSYPVFLVNSVNPARIEGQKTGAFEVVDVLSDAP
DIHALPVGNAGNITAYWQGYREYAAPFGDQPAVSSKLPKMWGFQAAGSAPIVAGHPITEP
DTIATAIRIGNPASWDQAVAARDESGGVIESVTDEQILEAHRWLSAQEGVFVEPASAAGV
AGILKKYRAGELAAGQTIVITVTGHGLKDPEWALRNLDGSPVEPRKVEFDVVSVARELGL
EN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaatggcgcggagtaattcgtgaatacgccgaccgcttgccggtcaccgaa
tcaactaaggtcatcacgcttggcgagggcggtacgccgctggtgcccgcacgagcatta
tatgagctgaccggctgtaacgtttacgtcaaggtcgagggcatgaacccgaccggtagt
ttcaaagatcgcggtatgacgatggcgattacggccgctgttgaggccggcgctaaggcc
gtcgtttgcgcttctaccggaaacacttcggcttcagctgctgcttacgcgaccgctgcc
ggcctgacttgcgcagtgctcgttccggccggaaaaattgcgatgggcaagctcagccaa
gcagtggcacatggtgcaacattgcttcaagttgatggcaactttgacaattgtttggaa
gttgcgcgtaagttggcggactcgtacccggtatttttggtaaattcggtcaacccagcg
cggattgagggccaaaaaactggcgcttttgaagtcgtagatgtgttgagcgacgctccc
gacatccatgcactcccggtagggaatgccggaaatattacggcatattggcagggctac
cgtgaatacgctgcaccgtttggtgatcaaccagcggtgtcttcgaaacttcctaaaatg
tgggggttccaagcagctggttctgcaccaatcgtggcgggccatcccatcaccgaacca
gacacaattgctaccgctattcgaatcggaaacccggcttcgtgggatcaagctgttgcc
gcgcgcgatgaatcgggtggcgttattgaatcagtaaccgatgaacagatccttgaagcg
caccgctggctttcggcccaagaaggggtcttcgttgaaccagcctcagcggccggcgtt
gcgggcattctgaagaaatatcgagccggagaattagctgctggccagacaatcgtgatc
acggtaaccggccatggtcttaaagacccagagtgggccttacgaaacctcgatggcagc
ccggttgagcctcgcaaggtggagttcgacgtcgtgagcgtcgctcgcgaactaggtttg
gaaaactga

DBGET integrated database retrieval system