KEGG   Renibacterium salmoninarum: RSal33209_1467Help
Entry
RSal33209_1467    CDS       T00641                                 

Definition
(GenBank) pyrazinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00760  Nicotinate and nicotinamide metabolism
rsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RSal33209_1467
Enzymes [BR:rsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     RSal33209_1467
    3.5.1.-  
     RSal33209_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ABY23203
UniProt: A9WNP0
Position
complement(1258025..1258642)
Genome map
AA seq 205 aa AA seqDB search
MAQALIIVDVQNDFCEGGSLAVDGGAEVATAISELLDDATEFDVVAATQDWHIDPGSHFS
ETPNFQDSWPVHCVAGSRGAQLHANLDAEYIDAYFRKGQFSAAYSGFEGILAADLEVPLG
EAKASQELTSEDRSSLDDWLRENDVHTVTIAGLATDHCVRATALDAIQAGYDVRLLVNLC
AGVDVEASEAALAEMADAGVELVVE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagctctcatcatcgtggacgtgcagaacgatttctgcgaaggcggttcgctt
gcggtcgacggcggcgctgaggttgccaccgcaatcagtgagctgctcgacgacgccacc
gagttcgatgtggtggcagcaactcaggattggcacattgatcccggttcacatttctct
gagacgccgaattttcaagattcatggccggtgcattgcgtggcaggttcacgcggagcc
cagctgcatgcaaatttggacgcagagtacattgatgcttacttccgaaaaggccagttt
tcagctgcatattcggggttcgagggcatcctagcagcagatctagaggtgccgttaggc
gaggcgaaagccagccaagaactcactagcgaggatcgatcgagcttggacgattggcta
cgcgaaaatgacgtacatacggtgaccatcgccggactcgccactgatcattgtgttcgc
gcaaccgctttagacgcaatccaggctggctacgatgtgcggcttttggtgaacttgtgc
gccggtgtggatgtcgaagcctcggaagcagctttggcagagatggcagacgccggcgtc
gaactcgttgtagagtaa

DBGET integrated database retrieval system