KEGG   Renibacterium salmoninarum: RSal33209_1750Help
Entry
RSal33209_1750    CDS       T00641                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsa  Renibacterium salmoninarum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RSal33209_1750
   00052 Galactose metabolism
    RSal33209_1750
   00500 Starch and sucrose metabolism
    RSal33209_1750
   00520 Amino sugar and nucleotide sugar metabolism
    RSal33209_1750
Enzymes [BR:rsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RSal33209_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1510695..1511597)
Genome map
AA seq 300 aa AA seqDB search
MTKAQRIRKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVQEAVDAGLEDVLMIT
GRNKRALEDHFDRVPNIERLLEAKGDAERLEAVQHATDLGEIHYVRQGDPKGLGHAVLRA
KTHVGDEPFAVLLGDDLIDERDELLSTMLEVQESTGGSVIALIEVEPARISAYGCVDMTP
IDGKDYVRVNELVEKPAVEDAPSNLAVIGRYVLHPRVFEVLENTLPGRGGEIQLTDALQT
LATSEGEGSGVYGVVFSGRRYDTGDKLSYLQAVVTLGCENAELGPDLRAWLKDFSTTLDR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgcaacgcatccgtaaagcagtcattccagctgcaggtttgggcactcga
tttttgccagcgacaaaagctatgccaaaagagatgctccccgtagtagataaacctgcc
atccaatacgtggttcaagaagccgttgacgcgggccttgaagatgtattgatgatcact
gggcgtaataaacgagcactggaagatcattttgatcgggtgccgaacatcgaacgtctc
ctggaggctaagggagacgcggagcgcctagaagccgtccagcacgctactgatcttggc
gagatccattacgttcgccagggcgaccccaagggtcttggccatgccgtgcttcgcgct
aaaacccacgtgggcgatgaaccatttgcggtactgcttggtgatgatttgattgatgag
cgcgatgagctcctttcaaccatgttggaagttcaagagagcaccggcggatcggttatc
gccttgatcgaagttgaaccggcaaggattagcgcctatggctgcgtcgatatgactccg
attgacggcaaggactacgtccgtgtcaatgaattggtggagaagcccgcggtggaggat
gcgccgtcgaacttggctgtgattggccgatacgtgctgcatccgcgagtttttgaggtg
ctagaaaatacgctgccaggccgcggcggcgaaattcaactcaccgatgcgctgcagacc
ctagctacttccgaaggtgaaggctctggagtttacggtgtggtcttttccggccggcga
tatgacaccggtgacaagctgagctacttgcaggccgtagtcactctaggttgtgagaat
gccgagctcggaccggatctgcgtgcctggttgaaggactttagtaccacgttggaccgt
tga

DBGET integrated database retrieval system