KEGG   Renibacterium salmoninarum: RSal33209_1948Help
Entry
RSal33209_1948    CDS       T00641                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rsa  Renibacterium salmoninarum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RSal33209_1948
Enzymes [BR:rsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RSal33209_1948
Exosome [BR:rsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSal33209_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1705259..1706773)
Genome map
AA seq 504 aa AA seqDB search
MSQYVIAIDQGTTSSRAIIFDHDGNIVSTGQLEHEQIFPKAGWVEHNATEIWNNTREVIG
TALSKANLTRHDIAAVGITNQRETAVVWDKTTGEPVYNAIVWQDTRTQSIVDELAVGGGV
ERFKDKVGLPLATYFSGTKIKWILDNVDGARERAAAGDLLFGNTDSWVTWNLTGGVDGGV
HITDVTNASRTMFMDLATLSWDQEILDAFGVPASMLPTIKSSSEVYGTVHTSQLLREVPV
AGILGDQQAATFGQAAFNTGEAKNTYGTGCFLIFNTGEEIVHSKNGLLTTVGYKLGDAPT
HYALEGSIAVAGSLIQWLRDTLGMISSAPEVEELAASVEDNGGVYIVPAFSGLFAPYWRS
DARGAIVGMTRYVNRNHIARAALEATAFQTREVLDAVNADSGVPLTELKVDGGMVANDAL
MQFQADILGVPVIRPKVTETTALGAAYAAGLAVGFWNDLGELSSNWAEDKRWEPAMEEDE
RARQLRLWKKAVTKSMDWVDEDVR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagtatgtcatcgcgatagaccaggggaccaccagctcgcgggcgattattttc
gaccacgacggaaacattgtctccactggacagcttgagcacgagcaaattttccctaag
gctggttgggtggaacacaacgccaccgaaatctggaacaacacgcgcgaggttattggt
accgcgttgtccaaggccaacctcacacggcacgacatcgccgcagtgggtattacgaat
cagcgcgaaaccgctgttgtctgggataagaccacgggtgagccggtttacaacgcgatt
gtttggcaagacacgcgcacgcaatcaattgttgatgaattggcggtaggtggcggcgtg
gagcggttcaaagacaaggtcggcttgccgcttgctacctatttctcgggtacaaaaatc
aagtggattctagacaacgttgacggcgcgcgcgaacgggcagcggctggagatttactc
tttggcaacaccgactcctgggtgacctggaacctcactggcggcgttgacggcggcgtc
cacattaccgatgtgaccaacgcctcgcgcaccatgtttatggacctagcgaccttgagc
tgggaccaagagatcctggacgcatttggcgtaccggcttcgatgctgccaaccatcaag
tcttcctccgaggtctatggcaccgtgcacacttcgcagctgttgcgcgaggttccggtt
gcgggcattctgggcgatcagcaggccgcgaccttcggtcaagccgccttcaataccggc
gaagcaaagaacacttatggcaccggttgcttcctgattttcaacacgggcgaagagatt
gttcattcgaagaacggattgctgaccaccgttggttacaaacttggggatgcgccgacg
cactatgcgttggaaggctcaatcgccgtcgccggctcgctcattcagtggctacgcgat
accttgggcatgatttcctcagcgcccgaggttgaagagctcgctgcttcggtcgaagac
aacggcggtgtctacattgtgccggcgttctccggtctgtttgcaccgtactggcgttca
gatgcgcgcggtgcgattgtcggcatgacccgctacgtgaatcgcaaccacattgcccgc
gccgcgctggaagctactgctttccaaacgcgcgaggttctcgatgcggtcaacgcagac
tccggcgttccgctgactgaactcaaggtcgacggcggcatggtcgccaacgatgcactg
atgcagttccaagccgatattctcggtgtcccggtcatccggccaaaggtcaccgagacg
acggcgctgggcgcggcttacgcggccgggctcgccgtcggcttctggaacgatctgggc
gagttgtcctcaaactgggctgaggacaagcgctgggagcccgcgatggaagaggacgag
cgtgctcggcagctccgcctttggaaaaaggcagtcaccaagtcaatggactgggtcgac
gaagacgtccgctaa

DBGET integrated database retrieval system