KEGG   Renibacterium salmoninarum: RSal33209_2004Help
Entry
RSal33209_2004    CDS       T00641                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rsa  Renibacterium salmoninarum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rsa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1764418..1767084
Genome map
AA seq 888 aa AA seqDB search
MCGIAGYYGYGEDEAMLKAMSATIAHRGPDGEGFYTQDSVGFAHRRLAIIDVAHGQEPMI
SQDGKTVLVYNGAVYNYLDLRAELEALGRTFVTNSDTEVILQAYEEWGEESFDRFNGMFG
FAIHDQAKQKLILARDHFGIKPLYFANTGTPDAPALVFGSEIKPLLATGKVAKKVDERIL
YRYLQFRIHDEEPATFFDGILKLMPGEKLVLDTSTGEHAISMFTRLPEELKELAKIDTPY
SKAVIDEYRERFTESVRLRLRSEVPVGTALSGGLDSSAVVVTINKLMQEKAAATDSLGST
QQTFSAVFPNSINDEEKYADAVIARCEGNVTSHKIKPKSAEFAEDLEDFVRTQEEPIISS
GPYAQYQVMRKASQHVTVLLDGQGADEMMAGYIPYYFAYLRQLKKKGQYAKLAKEMLSSS
DILFRLGRFRLQDAVTVRKQITIGPLLAKSFTAQHKSERFSNIPDNMKLRLIDDLFHKSL
PSVLRYEDKNTMRFSIEGRVPFLDKEVVKFLFSLSDESIIKGGWNKRILRDATRGLLPEM
ISNRRNKIGFTTPEAEWFVNMKEKLYEIFLSSSFEARPYWNSDAVLYAFEEYLSGKSSGS
TMVFWRLLNTELWLREFFDEPEVKVGIEGKSDYIPNADKQLEITVPADGKTYRRYPLRTE
IFYKETDLDPATLSYVQRFVDGLPAAGAEHNAATADAPWYLFVSEKIVAMTQGRSIPVWD
IKVSAAARTLSKFVVRNPGGIGLASPWSMQLAIEEVGLPRILWASFRSVIGKFQGKKGVF
YDVVGHNINAIDGAAGYQVGTSTHSVKYAPIDPDGVARRLSGKIRDLLPAEFAKNFAGTA
IMDANDLGVVALGHDTALSKDVLEGIFKDNPQGQSTETTPMSIVFLQK
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgccgggtattacggctatggcgaagacgaggcgatgctcaaagcgatg
agcgcgactattgctcatcgcgggcctgatggtgagggtttttacacccaggattcggtg
ggctttgcgcaccgccgactcgcgatcatcgatgtagcccacggccaagagccgatgatc
agccaggacggcaaaacggtgctggtctacaacggcgcggtctataactacctagatctg
cgtgccgagctagaagcactgggtcgcacttttgtgactaattcagatactgaagttatc
ttgcaggcttacgaagagtggggcgaagagtctttcgaccggttcaatggcatgttcggc
tttgccatccatgatcaggcgaagcagaaactcatcttggctcgcgatcacttcggtatc
aagccgctttattttgctaatactggcactccagatgcccccgcactggtctttggatca
gaaatcaaaccgctgctcgctaccggcaaggtcgccaaaaaggtcgacgagcgaattctt
taccggtacttgcaattccgaattcacgatgaagaaccagctaccttcttcgatggcatt
ctgaaactgatgcctggcgaaaagctggttctggataccagcaccggcgagcacgccatc
agcatgtttacgcggctgcctgaagagctcaaagagctcgccaaaatcgacactccttac
tcgaaagccgtcatcgatgagtaccgtgagcggttcaccgaaagcgtgcgactgcgtttg
cggtctgaagtcccggtgggcacagcactatccggcggactggactcttccgccgtcgtc
gtgacgatcaataaactcatgcaggaaaaagctgccgctacggattcgctcggcagcacc
cagcagactttctcggcggttttccccaactcgatcaacgacgaagaaaaatatgctgat
gcggtaattgcgcgttgcgagggaaacgtcactagtcacaagatcaagccgaaatctgcc
gagttcgctgaggatctagaagacttcgtgcggacgcaggaagagccgatcatttcctct
ggcccttatgcgcagtaccaggtgatgcgcaaggcatcccaacacgttacggtgcttctg
gacggccagggtgctgatgaaatgatggccggttacattccttactactttgcttacctt
cgtcagctgaagaaaaagggccagtacgccaaactagctaaagaaatgctctccagctca
gacattttgttccggctgggtcgtttccgcctgcaagacgcagttactgtgcggaaacag
atcactattggtccgttgctggctaaatccttcacggcgcaacataagagtgagcgtttt
agcaatattccagacaatatgaagctgcgtctgatcgacgatcttttccacaaatcgctg
ccctcggtgctgcgctatgaggataagaacacgatgcgcttctcgatcgagggtcgcgtg
ccgttcctggacaaggaagtcgtcaaatttctcttcagcttgagtgatgaatcgatcatc
aagggcggctggaacaaacggattttgcgcgatgcgacccgtggcttgctgccggaaatg
attagcaaccgccggaacaagattggcttcaccacccctgaagccgagtggtttgtgaac
atgaaggaaaagctctacgagattttcctctcttcctccttcgaggcccgtccttattgg
aatagcgatgccgtgctctatgcctttgaggaatacctcagcggcaagtcctccggctca
accatggtgttctggcgcctactcaacaccgagctctggttgcgcgaattctttgatgag
cctgaggtcaaagtcggcatcgagggcaagagcgactacattcctaatgcggataagcag
ctcgagatcacggtgccagccgacggtaagacgtatcgtcggtaccccttgcggaccgaa
attttctacaaggagaccgacctggacccggcgactctgagctacgtgcaacgctttgtt
gatggcttgccagcggccggtgccgagcataacgcagccactgctgatgcgccgtggtac
ctctttgtcagtgaaaaaatcgtcgcgatgacgcaaggccgatcaattccggtctgggac
atcaaagtcagcgccgcagcgcggaccttgagcaagtttgtggtgcgcaaccccggtggt
attgggttagctagcccgtggtcaatgcaattggccatcgaagaggttgggctcccccga
attctttgggcatctttccgatcggtgatcggtaagttccagggcaagaagggcgtcttt
tacgacgtcgtcgggcacaatattaacgccattgatggggccgctggttaccaggtgggc
acctcgacgcactccgtaaagtacgctccgatcgatcccgacggcgtggcacgcaggttg
agcggcaaaatccgagatctgctgcctgccgagttcgcgaagaactttgccggaaccgca
atcatggacgcaaacgatctgggtgtggtggccttgggccacgacacagcgttgtcgaag
gatgttttggaaggaatcttcaaagataatccgcaaggtcaaagcaccgaaacgacgccc
atgtcgatagtttttctgcagaagtaa

DBGET integrated database retrieval system