KEGG   Renibacterium salmoninarum: RSal33209_2255Help
Entry
RSal33209_2255    CDS       T00641                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00010  Glycolysis / Gluconeogenesis
rsa00051  Fructose and mannose metabolism
rsa00562  Inositol phosphate metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01130  Biosynthesis of antibiotics
rsa01200  Carbon metabolism
rsa01230  Biosynthesis of amino acids
Module
rsa_M00002  Glycolysis, core module involving three-carbon compounds
rsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSal33209_2255
   00051 Fructose and mannose metabolism
    RSal33209_2255
   00562 Inositol phosphate metabolism
    RSal33209_2255
Enzymes [BR:rsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RSal33209_2255
Exosome [BR:rsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RSal33209_2255
  Exosomal proteins of bladder cancer cells
   RSal33209_2255
  Exosomal proteins of melanoma cells
   RSal33209_2255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABY23986
UniProt: A9WT48
Position
complement(1996084..1996899)
Genome map
AA seq 271 aa AA seqDB search
MTTSTNGKFDRTPLIAGNWKMNMDHVQGITLLQKLAWTLSDAKHDYSRVEVAVFPPSTDL
RGVQTLVQGDQLKIVYGGQDLSDQDSGAYTGDISGAFLAKLGCRYVLVGHSERRTIHQES
DELLNRKLKAAYKHKVTPILCVGEGLEIRQAGTHVEHTLAQVRADVAGLSEEQAAELVIA
YEPVWAIGTGEVAGPQDAQEMCAAIRAELVELFDQAIADKIRLLYGGSVKANNVATILRE
RDVDGVLVGGASLEPAEFANIVRFESHLLTD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacatcgacaaatggcaaatttgaccgcactccgctcattgctggcaattggaag
atgaacatggaccatgtccagggcatcaccttgctacagaagctggcctggaccctctct
gatgcgaagcatgactacagtcgggtggaggtagcggttttcccgccatctactgatttg
cgcggcgtgcaaaccttagtccagggcgaccagctgaagattgtttatggcggtcaagac
ttatcggaccaggattccggcgcatataccggagatatttctggcgcctttttagccaag
ctgggctgccgttatgttcttgttggacacagcgagcgacggacgattcaccaagaatct
gatgaacttctcaaccgaaaactcaaagccgcctataagcacaaggtcacaccaattctg
tgcgtcggcgaaggcttagagattcggcaagcaggcacgcacgttgagcacacgctggct
caggttcgggccgatgttgctggattgagtgaggagcaggccgcagaactggtcattgcc
tacgagcccgtctgggcgattggtaccggagaagttgcaggtccgcaggacgcccaagaa
atgtgtgcagcgatccgcgccgagctcgtagaactcttcgatcaagcgatcgcagataag
attcggttgctttacggcggctcggttaaggcgaataatgtcgcgacgatcttgcgtgag
cgcgacgtcgatggcgtgttggtcggcggtgcgagtttggaaccagctgagtttgctaat
attgtcaggttcgagtcacatcttctgactgactga

DBGET integrated database retrieval system