KEGG   Renibacterium salmoninarum: RSal33209_2333Help
Entry
RSal33209_2333    CDS       T00641                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsa  Renibacterium salmoninarum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSal33209_2333
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSal33209_2333
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSal33209_2333
Enzymes [BR:rsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSal33209_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2072821..2074137)
Genome map
AA seq 438 aa AA seqDB search
MANSANTGTPDGAEDTAASFLAGARPASLKHASGPYFGEYGGRWMPESLIAAIDELEDTF
EKAKADPEFLAEIAWLNKNYSGRPSLLTEAERFAEHAGGARVFLKREDLNHTGSHKINNV
LGQALLAKRMGKTRIIAETGAGQHGVASATAAALLGLECVVYMGAEDTRRQSLNVARMKL
LGATVIPVTNGSQTLKDAINEALRDWVANVGTTHYLLGTAAGAHPFPAMVRFFHEVIGEE
AREQILEQIGRLPDAVCACIGGGSNAIGIFHGFLDDAEVKIFGFEAGGDGVETGRHAATI
TLGRPGVLHGARSYLMQDEDGQTVESHSISAGLDYPGVGPEHSYLADIGRVTYEPVTDTE
AMEAFRLLCRTEGIIPAIESAHALAGAMRVGKKLTEGVADPKQVVLLVNLSGRGDKDVGT
AAEWFDLLDAKNDEGAGE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactcagccaataccggcacacccgatggagccgaagacaccgccgctagcttc
cttgctggcgcacgccccgctagcctgaagcacgctagtggcccgtactttggtgagtac
ggcggacgttggatgccggaatcgctgattgctgcgattgacgagttggaagacaccttt
gagaaagccaaggctgatccggaattcctcgccgaaattgcctggctgaacaagaattac
tccggtcggccctccttgctcacagaagcggaacggtttgcagagcacgctggcggagct
cgagttttcttaaagcgcgaggacctcaaccacactggttcgcacaaaattaacaatgtg
ctcggccaggctctgctcgcgaagcgaatgggtaaaactcgtatcatcgcggagaccggt
gccgggcagcacggagttgctagcgccacagcagcggccctactgggcctggagtgcgtt
gtgtacatgggcgctgaagacactcgacggcagtcgcttaacgtcgctcgaatgaaacta
ctgggcgccaccgtgattccggtgaccaacggctcgcagacgctaaaagatgcgatcaat
gaagcattgcgcgattgggtcgccaacgtaggtaccacgcactacctgcttggtaccgct
gccggagcgcaccccttcccggctatggtgcgctttttccatgaagtcattggtgaagaa
gctcgcgagcagattcttgagcaaatcggtcggttgccggatgcggtctgcgcttgtatc
ggtggtggctcaaatgcgattggcatcttccacggattcttggacgatgccgaggtcaag
atttttggcttcgaggcaggtggcgacggcgtagaaactgggaggcatgccgctaccatc
acgctgggacggcccggagttttgcacggagctcgatcttatttgatgcaagatgaagac
ggccagactgttgagtcgcattcaatttcagctggtttggactacccaggagttgggccg
gagcattcttatttggccgacatcggccgggtaacttatgagccggtaacggacactgag
gccatggaagccttccggttgctttgccgcactgagggcatcattccggcaatcgaatct
gcgcacgcgctggcaggtgccatgcgcgtaggcaagaagctcaccgaaggcgttgcagac
ccgaagcaagttgtgctgctggtgaacttgtccggccgtggcgataaggacgttggcacc
gccgccgaatggtttgacttacttgatgccaaaaacgacgaaggtgccggcgaatga

DBGET integrated database retrieval system