KEGG   Renibacterium salmoninarum: RSal33209_2433Help
Entry
RSal33209_2433    CDS       T00641                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00020  Citrate cycle (TCA cycle)
rsa00310  Lysine degradation
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01130  Biosynthesis of antibiotics
rsa01200  Carbon metabolism
Module
rsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSal33209_2433
  Amino acid metabolism
   00310 Lysine degradation
    RSal33209_2433
Enzymes [BR:rsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RSal33209_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh SseB_C
Motif
Other DBs
NCBI-ProteinID: ABY24159
UniProt: A9WS30
Position
2168752..2169291
Genome map
AA seq 179 aa AA seqDB search
MPFIAKAVAEALKQHPKVNASYDEEKQEITFHDAEHLAIAVDTDRGLLVPVIADAGNLNL
AGMASKIADVASRTRNNKIGPDELSGGTFSITNFGSVGALFDTPIINQPQVAILGVGSIV
KRPVVVTDANGDDTIAIRQMMYLSMTYDHRLVDGADAGRFLQTLKARLEEGAFEADLGL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttcatcgcaaaggcggtggccgaggcgctcaagcagcacccgaaggtcaacgcc
tcctacgatgaggaaaagcaagaaattaccttccacgacgcggaacacctggcgatcgcc
gtcgacactgaccgtggtttacttgttccggtgatcgctgacgctggcaacttgaacctg
gccggtatggccagcaagatcgctgacgtagcctcccggacccgcaacaacaagatcggt
ccggatgaactatccggtggcacgttctcgatcaccaacttcggctcggttggcgcgctc
tttgataccccgattatcaaccagccgcaggtcgcgatcctcggcgtcggctcgatcgtg
aagcgtccggtagttgtgaccgatgctaatggcgacgacaccattgcgatccgccagatg
atgtacctttcgatgacgtatgaccaccggttggttgacggcgccgatgcgggacgattc
ttgcagacgctgaaagcacgtttggaagaaggcgctttcgaggctgacctgggtctctaa

DBGET integrated database retrieval system