KEGG   Renibacterium salmoninarum: RSal33209_2474Help
Entry
RSal33209_2474    CDS       T00641                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00010  Glycolysis / Gluconeogenesis
rsa00520  Amino sugar and nucleotide sugar metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01130  Biosynthesis of antibiotics
rsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSal33209_2474
   00520 Amino sugar and nucleotide sugar metabolism
    RSal33209_2474
Enzymes [BR:rsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     RSal33209_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABY24200
UniProt: A9WS71
Position
2202837..2203637
Genome map
AA seq 266 aa AA seqDB search
MSKNADKSQNPQHIIGIDIGGTGIKGGIVNLKKGELSGDRFRIDTPQPSTPKAVAEVVKQ
IVDELMSREDAPSKDSPVGVDFPAIIAHGVARSAANVDKSWIGTDVDDLLTKKLGRPVHV
MNDADAAGVAEVAYGVGQGQKGTVLVITLGTGIGSAFIFNGKLVPNAELGHLELDGFDAE
SRASASAREREDLDWDEYSKRLQRYFSHVEFLFSPELFIIGGGISKRSEDFLPKLDLQTK
IVTAELKNNAGIVGAALQASRHFKKK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacgctgataagtcgcaaaacccccagcacatcatcgggatcgacattggt
ggcacgggcatcaaaggtggcatcgtcaacctgaaaaagggtgagctctctggtgatcgg
ttccgcatcgacacaccacaaccgtcaacccctaaagcagtagcggaggtcgtcaaacaa
atcgtcgacgagctgatgtcgcgcgaggatgccccgtccaaggacagtccggttggcgtt
gattttccggccatcatcgcgcacggcgttgctcggtccgccgccaacgtagacaaaagt
tggattggtaccgacgtcgatgatttactcaccaaaaaattgggccgaccagtacatgtc
atgaacgacgccgacgccgccggagtcgccgaggttgcttacggcgttggccaagggcaa
aaaggcaccgtgctagtgatcactctgggcaccggaatcggatctgcgtttatcttcaac
ggcaagctggtcccgaacgcagaactcggacacttggaactggacggattcgacgccgag
tcacgcgcttcagcgtcggcccgcgaacgcgaagatcttgactgggatgaatacagcaag
cggctacaacgctatttctcccacgtagagttcctgttctcccccgaattgttcatcatc
ggtggcggaatttccaagcgaagcgaagacttcttgcccaagctagatttgcaaaccaag
attgtcaccgcggaactgaaaaataacgccgggattgttggggcggcactacaggcctcg
cggcatttcaagaaaaaatga

DBGET integrated database retrieval system