KEGG   Renibacterium salmoninarum: RSal33209_2474Help
Entry
RSal33209_2474    CDS       T00641                                 

Definition
polyphosphate ATP-glucomannokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
rsa  Renibacterium salmoninarum
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rsa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsa00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rsa00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2202837..2203637
Genome map
AA seq 266 aa AA seqDB search
MSKNADKSQNPQHIIGIDIGGTGIKGGIVNLKKGELSGDRFRIDTPQPSTPKAVAEVVKQ
IVDELMSREDAPSKDSPVGVDFPAIIAHGVARSAANVDKSWIGTDVDDLLTKKLGRPVHV
MNDADAAGVAEVAYGVGQGQKGTVLVITLGTGIGSAFIFNGKLVPNAELGHLELDGFDAE
SRASASAREREDLDWDEYSKRLQRYFSHVEFLFSPELFIIGGGISKRSEDFLPKLDLQTK
IVTAELKNNAGIVGAALQASRHFKKK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacgctgataagtcgcaaaacccccagcacatcatcgggatcgacattggt
ggcacgggcatcaaaggtggcatcgtcaacctgaaaaagggtgagctctctggtgatcgg
ttccgcatcgacacaccacaaccgtcaacccctaaagcagtagcggaggtcgtcaaacaa
atcgtcgacgagctgatgtcgcgcgaggatgccccgtccaaggacagtccggttggcgtt
gattttccggccatcatcgcgcacggcgttgctcggtccgccgccaacgtagacaaaagt
tggattggtaccgacgtcgatgatttactcaccaaaaaattgggccgaccagtacatgtc
atgaacgacgccgacgccgccggagtcgccgaggttgcttacggcgttggccaagggcaa
aaaggcaccgtgctagtgatcactctgggcaccggaatcggatctgcgtttatcttcaac
ggcaagctggtcccgaacgcagaactcggacacttggaactggacggattcgacgccgag
tcacgcgcttcagcgtcggcccgcgaacgcgaagatcttgactgggatgaatacagcaag
cggctacaacgctatttctcccacgtagagttcctgttctcccccgaattgttcatcatc
ggtggcggaatttccaagcgaagcgaagacttcttgcccaagctagatttgcaaaccaag
attgtcaccgcggaactgaaaaataacgccgggattgttggggcggcactacaggcctcg
cggcatttcaagaaaaaatga

DBGET integrated database retrieval system