KEGG   Renibacterium salmoninarum: RSal33209_2516Help
Entry
RSal33209_2516    CDS       T00641                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rsa  Renibacterium salmoninarum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2249344..2250114
Genome map
AA seq 256 aa AA seqDB search
MEATTMALHDPMTSPGHGDLARIGVVVSHGFSGSPESVRPWAEHFAAQGFAVRMPLLPGH
GTSWQEMSRTPWQRWYSEVERAYFELASTCEQVFVAGLSMGGALALRIAEHHPVAGLALV
NPALAVVDPRAKLAGLMQYVLKSTPAIGNDILKPGAEEYAYDRTPVASVAQLMKLIKDTS
GNLAKVTAPITVFHSTVDHIVAASSVARIQAGVSSKDVHILKLSNSYHVATLDNDAPEIF
TRSSDFFKELAGVHNS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaaccacaatggccttgcatgatccaatgacgtcgccgggacacggcgatttg
gcgcgcatcggcgtcgtagtttcgcatggcttctccggttcgcccgaaagcgtccggcct
tgggcagaacatttcgctgcccaaggtttcgcggtcagaatgccattgctacccgggcac
ggtactagctggcaagaaatgtctcgaacaccctggcaacgctggtactcggaagtggaa
cgggcctattttgaactggccagcacttgtgagcaagtttttgttgctggactttcgatg
ggcggcgcgcttgcgctacgaatcgcagagcatcatccagtggcgggccttgccttggtc
aatccggcgctggctgtggtggacccccgagccaagctcgctggcctgatgcaatatgtg
ctcaaatcgacgccggcaattggcaatgacattttgaagcctggcgcggaggaatacgcc
tacgaccgaacgccagttgcctcggtagctcaactgatgaagctcatcaaggacaccagc
ggaaatctagcgaaagttaccgcgccgatcacagtttttcactcaaccgtggatcacatt
gttgcggcgtcctcggtggcccggattcaggccggagtttccagtaaagacgtgcacatt
ctgaaattgtccaacagctatcacgtagccactttggataatgacgcccccgaaatattt
acccgttcaagcgatttcttcaaggagctggccggtgtccacaactcctga

DBGET integrated database retrieval system