KEGG   Renibacterium salmoninarum: RSal33209_2651Help
Entry
RSal33209_2651    CDS       T00641                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsa  Renibacterium salmoninarum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rsa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rsa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rsa00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2376661..2378019)
Genome map
AA seq 452 aa AA seqDB search
MGGLVVSATISTQSTGNQQVFLLPDLGEGLTEAELVRWLVSEGDTLVIDQPIAEVETAKS
LVEVPSPFAGFVAILHGSEGQLMDVGKPFLTVSRAIEPGEARDPHESYREEERAGSGNVL
IGYGTSGQTATARSRPRKAEATPAAPALAAAVGVSSVAPLVISPLVRKLARDSGISLHSV
TGSGPGGLILRQDLQLTGAAVTAAETGSTTPTESAGLDPRSGLSVLSRTPLTGIRKAIAA
NLSRSRTEIPEATVWVDVDATALLQMRDSLKKINPETTPGILAFIARFVLAGLARFPELN
TRIENGEIVAVDGVNLGFAAQTERGLMVPSVRAAQKLSARELDAEIRRLTAVARSGKATP
AELASGTFTLNNYGVFGVDGSAAIINYPESAILGVGRIIDKPWVVDGELAVRKLTELTLV
FDHRVCDGGTAGGFLRYVADAIENPGTLLADL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgggaggactcgttgtgagtgccacgattagtacgcaaagcactggcaaccagcaggtc
ttcctgctccctgatttgggcgaagggctgaccgaagctgaacttgttcgctggttggtc
tccgagggggataccttggtgatcgatcagccgattgccgaagtcgaaacggccaagtcg
ctcgtagaagttccctcgccgtttgccggcttcgtagccatcttgcatggttccgagggg
caattgatggatgtgggaaagcctttcctcacggtttcccgtgccatagagcccggtgaa
gcccgtgatccgcacgaaagctaccgtgaagaagagcgtgcgggcagtgggaatgtgctt
attggttatggcactagtggccaaacagccactgcgcgctccaggccccgcaaagccgaa
gctactcctgcagccccagctttggcggcagcagtcggagtgagctcagtcgcaccactg
gttatttcaccattggtccggaaactggcgcgtgattcaggtatctccttgcacagcgtc
actggctcaggtcctggcggtttgattttgcgtcaggatctccagctaaccggcgccgcc
gtaaccgcagcggaaacaggttcaacaacaccaaccgaaagcgctggcctggacccccga
tcggggctctcggtactttcgcggactccgctgaccggcatccgtaaggccatagcagcg
aacttgagccgaagccggacggaaatcccggaagcaacggtgtgggtcgatgtagatgcc
acggctctgctgcaaatgcgtgattcgctcaagaagatcaatccggagactacgcctggg
attctggcttttattgctcgatttgtgttggccggactggctcgattccccgagctgaat
actcggatcgaaaatggcgaaatcgtcgcggtcgatggagtgaacctcggcttcgcggcc
cagactgagcgcggtttgatggtgccgtcggttcgcgcagcgcaaaaactaagcgctcgc
gaactggacgccgagatcaggcggttgaccgccgtcgcccgctctggcaaagctacgcca
gcggaattggccagcggcaccttcacgctgaacaactatggcgtctttggtgtggacgga
tctgccgccattatcaactacccggaatcagcgatcttgggcgtcggccgaatcatcgat
aagccttgggttgtggacggtgagttggccgtgcgcaaactgacggagctgactttagtc
ttcgatcatcgagtgtgcgacggcgggacggcaggcgggttccttcgctacgtggctgac
gcgattgagaatcctgggacgctcttggccgatctttag

DBGET integrated database retrieval system