KEGG   Renibacterium salmoninarum: RSal33209_2768Help
Entry
RSal33209_2768    CDS       T00641                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00010  Glycolysis / Gluconeogenesis
rsa00620  Pyruvate metabolism
rsa00640  Propanoate metabolism
rsa00680  Methane metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01130  Biosynthesis of antibiotics
rsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSal33209_2768
   00620 Pyruvate metabolism
    RSal33209_2768
   00640 Propanoate metabolism
    RSal33209_2768
  Energy metabolism
   00680 Methane metabolism
    RSal33209_2768
Enzymes [BR:rsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RSal33209_2768
Lipid biosynthesis proteins [BR:rsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RSal33209_2768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABY24493
UniProt: A9WTH2
Position
2473807..2474694
Genome map
AA seq 295 aa AA seqDB search
MTILYAVPTAIRTFMKWGRDIPAKYDLSSLKVLGSVGEPINPEAWIWYREIIGGGKTPIV
DTWWQTETGGMMISPLPGVTATKPGSAQVALPGIEVDVVDDLGVPVGNGQGGYLVVKSPW
PSMLRGIWGDPERYKDTYWSRFDNMYFAGDGAKKDDDSDIWLLGRVDDVMNVSGRRLSTT
EIESALVSHPSVAEAAVVGAADETTGQAVAAFVILRGSAVDDPDVEQTLRNHVGKEIGPI
AKPKRILVVPELPKTRSGKIMRRLLKDIAEGRDAGDATTLADAGIMQLISDSLKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcctgtacgccgtgccaacggcaatccgcactttcatgaagtggggccgagat
attcccgctaagtacgatctgagttcactcaaggtgctcggttcggtcggcgagccaata
aacccagaagcttggatttggtaccgcgaaatcattggtggcggcaagaccccgatcgtg
gacacttggtggcagaccgagaccggcggcatgatgatttcgccgttgccaggtgtaaca
gcgacgaaacccggctcagctcaggttgcactgcctggcattgaagtggacgttgttgac
gatctaggcgtgccggtaggcaacgggcaaggtggttaccttgtggtgaagtcgccgtgg
ccctcgatgctccgcggcatctggggcgatccggaacggtacaaggacacctactggagc
cgtttcgacaatatgtacttcgccggcgatggggccaaaaaggacgacgacagcgacatc
tggttgctcggccgggtggacgatgtgatgaacgtgtctgggcgccgcctgtccaccacc
gaaatcgaatccgctttggtgagccatccctcggtggccgaggccgccgtcgtcggtgct
gcggatgagactaccggtcaggcggtagcggccttcgtgatcttgcgcggatccgcggtg
gatgatcccgacgtcgaacagaccctgcgcaatcacgtaggtaaggaaatcggcccgatt
gcgaagcccaagcggatcttagtggttccggagctgcccaagacccgctcgggcaagatt
atgcgtcgattgctcaaggacatcgctgagggccgtgacgcaggagacgcaacgaccctc
gcggacgctgggatcatgcagctcatttcggacagcctcaagaagtag

DBGET integrated database retrieval system