KEGG   Renibacterium salmoninarum: RSal33209_3023Help
Entry
RSal33209_3023    CDS       T00641                                 

Definition
phosphoribosylaminoimidazole carboxylase NCAIR mutase subunit (EC:4.1.1.21)
Orthology
K01589  
5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
rsa  Renibacterium salmoninarum
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RSal33209_3023
Enzymes [BR:rsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     RSal33209_3023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2702429..2703604
Genome map
AA seq 391 aa AA seqDB search
MTFPVIGVVGGGQLARMMAPAAIELGIELRVLAEASDVSAVPAVKQTPIGDYLDIEQLRA
FAQGLDVLTFDHEHVPTEHLATLIAEGVNVQPGPESLIHAQDKLVMRAAIDKLGLPNPAW
AAVESVQEIVDFAELHSWPVVLKMPRGGYDGKGVKILDSAADASGSATWFDAMSPLLVET
KVAFSRELSAMVARRPSGEAAAWPIVESIQVDGVCDEVIAPAQDLDPEIAERAQHTALRL
ADELGVTGAMAVELFETPGEGPGFVINELAMRPHNSGHWSMDGALTGQFEQHLRAVADLP
LGDPRPLAELTVMKNILGGANLDSFSAYPAAMAAQPGVKVHHYGKAVRPGRKIAHVNALA
LPGESLASVRARAESTALAIRDGHESRKASS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgacttttccagtaatcggtgttgttggcggtggccaattagcccgaatgatggcccca
gcggcaatagaactcggtattgaacttcgagtgctcgccgaggcttcagacgtctctgca
gtgccagcagtcaagcagacccccattggcgattacctagatatcgaacaacttcgagcc
ttcgcgcagggtcttgatgtacttactttcgatcatgagcatgtgcctactgagcatttg
gccacccttatcgccgagggcgtcaacgtccagcccggccctgaatctctcatccacgca
caggacaagctcgtcatgcgcgccgcaatcgacaagttgggcttgcccaatccggcttgg
gccgccgtcgaatcagtacaagaaatcgtcgacttcgctgagctgcacagttggcccgtc
gtgctgaaaatgccgcgcggcggttacgacggaaaaggcgtcaaaatccttgattcggct
gcggacgcaagtggctcggcaacgtggtttgacgcgatgagtccgttgttagttgaaacc
aaggtggccttcagccgagaactatctgcgatggtcgctcgccggcccagcggcgaagct
gccgcttggccaatcgttgaatcgattcaggtcgatggcgtctgcgatgaggtaatcgcc
cccgcccaggatctggacccagaaattgccgaacgcgcccagcacactgcgcttcggctt
gccgacgaactcggggtcaccggagcaatggcggttgaactttttgagacccctggcgaa
ggccccggctttgtcatcaacgaattggccatgcgaccgcataattctggccactggagc
atggacggagctctgaccggtcaatttgagcagcatctacgtgcagtagccgatcttccg
ctgggcgatcctcgaccactcgctgagctcacggtcatgaaaaatatcctcggaggagcg
aatctggactctttcagcgcttatcctgcggcgatggccgcgcaaccgggcgtcaaagtg
catcattatggcaaggcggtaagaccgggtcgcaaaattgcgcatgtcaacgcgctggcc
ttacccggggaatcattagcatccgtgcgggcacgagcagaatcaaccgcattagcgatt
agagatggtcacgagtcaaggaaagcgagttcctaa

DBGET integrated database retrieval system