KEGG   Renibacterium salmoninarum: RSal33209_3111Help
Entry
RSal33209_3111    CDS       T00641                                 

Definition
(RefSeq) D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
  KO
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rsa  Renibacterium salmoninarum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RSal33209_3111
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RSal33209_3111
Enzymes [BR:rsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RSal33209_3111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2771179..2771928)
Genome map
AA seq 249 aa AA seqDB search
MRIDGPLAGRRALVAGGANGIGAAVVRELASQGAKVTIADISAAEELAAAVSGEVWQVDL
SETSVLESIDLDFDILVNNAGIQRVAAIESYEPEMFRRIQTIMVDAPFLLIRAVLPGMYR
RGWGRIINMSSVHGLRASAFKSAYVTAKHGLEGLSKVTALEGGEHGVTSNCVNPGYVRTA
LVEAQIADQAKLHGIEESEVLAKIMLTESAIKRLVEPEEVASLVGWLAGPMAAMVTGASY
TVDGGWSAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgatggaccccttgctggacgccgagcattagtggccgggggagcgaacggc
atcggtgccgccgtcgtccgggaacttgcttctcagggcgcgaaggtaacaatcgctgat
atctcggccgccgaggaacttgcggcggctgtctccggagaagtctggcaagtagatctt
tcagagacatctgtgctggaatccatcgacctggattttgacatcttggtcaataacgcc
gggattcaacgggttgccgcaatcgagtcttacgaacccgagatgttccgacgaatccaa
acaattatggttgacgccccctttttgcttattcgagcggtacttccgggaatgtatcgt
cgaggttggggccgaataattaacatgtcttcggtgcatggtttacgagcttcggctttc
aaaagtgcctatgtcacggccaagcacggacttgaaggtctctcaaaagtgactgccctt
gagggcggtgagcatggggttaccagcaattgtgtcaatcccggttacgttcggacggcg
ctagtcgaggcacagattgccgatcaggccaagcttcatggcattgaggaaagtgaagtt
ttggccaagatcatgttgaccgaaagcgccatcaaacggcttgtcgagccagaggaagtt
gcatctcttgttggttggctagccgggccgatggccgcaatggtgaccggtgcgagttac
acggtcgacggcggttggtccgccaagtaa

DBGET integrated database retrieval system