KEGG   Renibacterium salmoninarum: RSal33209_3151Help
Entry
RSal33209_3151    CDS       T00641                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rsa  Renibacterium salmoninarum
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RSal33209_3151
Enzymes [BR:rsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     RSal33209_3151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2799471..2801300
Genome map
AA seq 609 aa AA seqDB search
MWAISPSSSAPTSIGTMPSAKQTLTFADGKLFRNGSEHRLLGGAIHYFRVHPSQWGNRLD
RLKALGANTLDTYVAWNFHQRRATDQADFSDWRDLVRFIEMAGEHGLDVMVRPGPYICAE
WDNGGFPAWLTGKTGLTLRSTDPAYQAAVSQWFDTLLPLLTPLQASNGGPIVAFQAENEY
GSYGDDLEYVAWTRQALAERGVTELIFSADGGNDFYLDGGALPTDAAEPMLATGTLGSRG
AEAIETWQHRRPGEHFIAAEFWNGWFDHWGEEHHRRDPAEAALEVKQILDGCGSICLYMA
HGCSNFGLTSGANYDGVLQPTVTSYDSDAPIGEDGRLTPKFHAIRELFGQYAELPELGSL
TEPNRVLPAQNLSLTPGLGLLEALREFSAKPSKTPLSFEELDCPEGLVLYRAQPILPRGE
FKLRIAELHDRAIVFIDGERVGVFEATVHEPLVLTGTGERAVVEILVENQGRINYGHLLG
QGKGILGGLLINQRLTFGWQNTPVPLVDVELPDLQRFANPTDRQPAGPGFFSATLNLAEP
LDTHLALPGFAKGFVWVNGFLLGRYWERGPQSTLYVPAALLSAGSNQITVLELDCAGTLV
ELHEATNLG
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgatctcgccgtcgtcgtctgctccgactagcatcggaaccatgccttctgcg
aaacagaccttgacctttgctgacggaaaactcttccgaaatggatccgaacaccgactc
ttaggcggcgcgatccattattttcgggtgcatccttcgcagtggggtaaccggctagac
cgcttgaaggcgctgggtgctaacactctggacacctatgttgcctggaactttcatcag
cgtcgcgcaactgaccaggccgatttcagtgattggcgcgatctggtgcgatttatcgaa
atggctggtgagcacggtctagatgtgatggtgcgccccggcccgtatatttgcgcggaa
tgggataacggtggtttcccggcatggctcaccggaaagaccggccttacattgcgcagt
accgatccggcctatcaagctgccgtgtcgcaatggttcgacacgttactacctttgtta
acaccgttgcaggccagcaacggtggaccaatcgtcgctttccaagcggaaaacgaatat
ggcagctacggcgatgatctcgaatacgtcgcttggaccaggcaagcattagcggagcgc
ggtgttaccgagcttatttttagcgctgacggtggcaacgatttttatttggacggcggc
gcgctgcccaccgatgccgcagaaccgatgctcgccaccggcaccctgggtagtcgaggt
gctgaggcgattgaaacttggcagcaccgcagaccgggcgagcatttcattgccgccgaa
ttctggaatggctggtttgaccattggggcgaagagcaccatcgccgcgatcctgccgag
gctgcactagaggtcaaacaaatcctcgacggctgcggatcaatctgcttatacatggcg
cacggctgcagtaatttcggcctcacttctggcgccaattacgacggcgtacttcaaccc
accgtaaccagctacgactcggacgcgccgatcggcgaagacggtcgattgacgccgaaa
tttcacgctattcgcgagctctttggccaatatgccgagctacccgaattgggctcgctg
acggagccaaaccgtgtgttgcccgcgcagaatctctctctgactccgggactaggactc
cttgaagcattgcgcgaattctcagctaaacccagcaagacgccactgagctttgaagaa
ctcgattgcccagagggccttgtgctgtaccgggcgcaaccaatcctgccgcgcggagag
ttcaagcttcgtatcgccgagttacatgaccgagccatcgtctttattgacggcgagcgc
gtcggcgtcttcgaggcaacggttcacgagccgttggttttgactggaaccggtgagcgc
gccgtcgtcgagattctggtcgaaaaccaaggtcgaattaactacggccaccttttgggc
caaggtaaaggtattttgggcggtctgctgatcaatcagcggctgacctttggctggcaa
aatacgccggtgccacttgtggacgtcgaactgccagacttgcagcgcttcgccaatcca
acggatcgccagccggcaggtcctggcttcttctccgccacgctcaatctcgcggagccg
ctggatacccacctcgccttaccgggatttgcaaagggctttgtctgggtaaatggcttt
ttgcttggccgctactgggaacgcgggccgcaaagcacgctctatgtaccagctgcgctg
cttagcgccggcagcaatcagatcacggtgctggaattggactgcgccgggaccctcgtc
gagctccacgaagccacaaatctcggttga

DBGET integrated database retrieval system