KEGG   Renibacterium salmoninarum: RSal33209_3205Help
Entry
RSal33209_3205    CDS       T00641                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rsa  Renibacterium salmoninarum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSal33209_3205
Enzymes [BR:rsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RSal33209_3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2849898..2850812
Genome map
AA seq 304 aa AA seqDB search
MSKKKILVFGSLNADLTIYCEKLPQPGETIHGSDFGVKPGGKIANQAVAAARLGGQVTLI
GAVGDDANGRMLQDSVQAAGADISQLRTVTEPTGVAVISVDSHGENSIIISAGANGTLSP
AHVAAADFSGAGVVCLCLEVSLETVLAAARAGHDAGATVMLNLSPYGAVPDELLELTDIL
LLNAHEAADLLGADHQGDWIAAGAHFAERGLPKVLVTLGGEGSVVLDSTSAEPVTKIDPL
KVSPIDTTGAGDAFTVAVAAQLASGASLVAAARFASVAAAIATTRKGAQASYPDAAEVAA
ELNR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagaaaaaaatcctagtttttggttcactcaatgcggatctgaccatctattgc
gagaagttaccgcagcctggtgagaccatccacggctccgattttggcgtgaaacccggc
ggtaagattgccaatcaagcagtggctgccgctcgtctaggtgggcaagtaactcttatt
ggcgccgtgggcgacgacgccaatggccgaatgctgcaggattctgttcaggcggccggc
gcggacatcagccaattgcgcaccgtaaccgaaccaactggggttgccgtgatttcagtg
gatagtcacggcgaaaatagcatcattatttccgcaggcgctaatggcaccctgagcccc
gcacacgttgccgcggccgacttctccggggccggcgtcgtctgcctttgtttggaagtc
tcattggagaccgttcttgctgcggctagggccgggcacgacgccggggccaccgtaatg
ctcaatctgtccccttatggtgcggtaccggatgagctgcttgagttgaccgatattttg
ttgctcaacgcgcacgaggccgccgaccttctgggtgccgaccatcagggcgattggatt
gccgccggtgcgcatttcgcggaacgtggactgcctaaggtcttagtaacgctcggcggt
gagggctcggtagtgctcgattcgacgtcggccgaacccgtaacaaaaatcgatccgctc
aaagtctcacctatcgacaccacaggtgcaggcgatgcctttaccgttgcggttgctgcg
caattggcttctggagcctcgcttgtggctgccgcccgctttgcctcggttgctgcggca
atcgcaactacccgcaagggcgctcaagcttcctacccggacgcggccgaggtagccgca
gaattgaatcgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system