KEGG   Renibacterium salmoninarum: RSal33209_3211Help
Entry
RSal33209_3211    CDS       T00641                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00790  Folate biosynthesis
rsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSal33209_3211
Enzymes [BR:rsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RSal33209_3211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK E3_UbLigase_EDD
Motif
Other DBs
NCBI-ProteinID: ABY24928
UniProt: A9WUQ7
Position
complement(2855276..2855782)
Genome map
AA seq 168 aa AA seqDB search
MSKLPVHSVLALGSNLGERLETLAEGVADVVEHPLVRLVDVSPVVQTQPVGGPAEQPLYL
NMVMEIETELSPTELLAHCQAVEAQHHRERIVRWGPRTLDVDIITYNDLQQDDPELTLPH
PRAAERAFVLVPWLLMNPQATLAGRTVRELAAAADDLHGVEDFDGYPS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaagctgccggtgcactcggtactggcgctcggctcaaaccttggcgagcgcctt
gaaacgctcgccgagggtgttgcagacgtcgtcgagcatcccttggttcgtttggtcgat
gtatcgccagtggtgcaaacgcagccggtaggtggtccggcggaacagccgctgtatctc
aacatggtgatggaaattgaaactgagctaagcccgaccgagctattggctcattgccag
gcagtcgaggcccagcatcaccgagagcgaattgtgcgctgggggccgcgcactcttgat
gtggacatcattacctacaacgatttgcagcaggacgatccggagctcacgttgccgcat
ccacgggcggccgagcgagcttttgtgcttgtgccgtggctattgatgaatccacaggca
acattggctggccgcacggtgcgtgagctcgctgccgcagcggatgatttgcacggcgtc
gaagactttgacggatatccctcctga

DBGET integrated database retrieval system