KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10201Help
Entry
RCFBP_10201       CDS       T01272                                 

Gene name
egl
Definition
endoglucanase (endo-1,4-beta-glucanase) (cellulase) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RCFBP_10201 (egl)
Enzymes [BR:rsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RCFBP_10201 (egl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(216074..217393)
Genome map
AA seq 439 aa AA seqDB search
MESTPRTALAGLLSRCWRFVAVALITTLLGACGGGDAEPTASTQATADTTALKAAATSTA
ASTSSVWLTVAKESAAFTVTGTQTVRFGAGGAWVEKSVSGKGQCTAAFFGQDPLAGNTRV
CQQLQGGGSLLWRGVSLAGADFAPDRLPGNYGSDYIYPSADSVPYYKNKGMNIVRLPFLW
ERLQPTLNQPFDATELSRLISFVRAVTLSGQTVLLDPHNYARYRGNVIGSAAVPETAYAD
FWRRLATQFKGNARVIFGLMNEPHSMPTEQWLSAANAALAAIRSANASNVVFVPGNAWTG
SRTWSDNWYGTPNSTVMRDVIDPGHNFVFEVHMYLDNDGSGSSATCASASIGVERLQNFT
TWLRANRYRGFLGEMGAGANALCNQAVSNALAFVRGNADVWTGWTWWAGGPWWGNYIYSI
EPSNGVDKPQMSVLSPYLN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggaatccacccctcgaaccgcgctcgccggtctgctgtcccggtgctggcgattcgtc
gccgttgccttgatcaccacgctgctgggcgcgtgcggcggcggcgatgccgagccgacg
gcgtctacgcaagccaccgccgacacgaccgctctcaaagccgcagccacctccacggca
gcgtccacatcatccgtgtggctcacggtggccaaggagagcgccgcttttaccgtgacc
ggcacccagaccgtgcgcttcggcgccggtggtgcctgggtcgagaagagcgtgtcgggt
aaaggccaatgcacggccgccttcttcggccaggacccgttggcggggaacaccagggtc
tgccagcagttacagggcggaggcagtctgctctggcgtggcgtcagcctggccggggcc
gatttcgcgccggaccgcttgcccggcaactacggcagcgactacatctatccgtcggcg
gacagcgtgccgtattacaagaacaagggcatgaacattgtgcgcctgccattcctgtgg
gagcgcttgcagccgacactgaaccagccgttcgatgccaccgagctgtcgcgcctgatc
agcttcgtccgggccgtcacgctgtccggccagaccgtactgctggacccgcacaactac
gcccgctaccggggcaatgtgatcggatcggcggcggtgcccgaaaccgcctacgccgac
ttctggcggcgcctggccacccagttcaagggcaatgcccgcgtcatcttcgggctgatg
aacgagccgcactcgatgccgaccgagcagtggctgtccgccgccaacgcggcactggcc
gccatccgcagcgccaacgccagcaatgtggtgttcgtgccgggcaacgcctggacgggc
tcgcgcacctggagcgacaactggtatggcacccccaacagcaccgtcatgcgggacgtg
atcgacccgggccacaacttcgtcttcgaagtccacatgtacctcgacaacgatggctcc
ggcagctcggcgacctgcgcgagcgcctccattggcgtcgagcgcctgcagaacttcacc
acctggctgcgcgccaaccgctatcgcgggttcctgggcgagatgggtgcgggcgccaac
gcgctctgcaatcaggcggtcagcaatgcgcttgccttcgtgcgcggcaacgccgatgtc
tggaccggctggacatggtgggcaggcggcccgtggtgggggaattacatctattcgatc
gaaccatcgaacggcgtggacaagccgcaaatgtcggtgctgagtccgtatctgaactga

DBGET integrated database retrieval system