KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10307Help
Entry
RCFBP_10307       CDS       T01272                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00010  Glycolysis / Gluconeogenesis
rsc00071  Fatty acid degradation
rsc00350  Tyrosine metabolism
rsc00625  Chloroalkane and chloroalkene degradation
rsc00626  Naphthalene degradation
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
rsc01120  Microbial metabolism in diverse environments
rsc01130  Biosynthesis of antibiotics
rsc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_10307 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    RCFBP_10307 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RCFBP_10307 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RCFBP_10307 (adhA)
   00626 Naphthalene degradation
    RCFBP_10307 (adhA)
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RCFBP_10307 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C adh_short 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBJ41617
UniProt: D8NLL3
Position
complement(320900..321925)
Genome map
AA seq 341 aa AA seqDB search
MARSMKAAVVHAFGEPLRIEEVPIPTPGRGQILVNIRASGVCHTDLHAADGDWPVKPRLP
FIPGHEGVGFVAAVGEGVSAVKEGDRVGVPWLYTACGHCEHCLGGWETLCHDQQNTGYSV
NGGYAEYVLADPNYVGHLPAQVGFEEIAPILCAGVTVYKGIRMTDTRPGQWIAISGIGGL
GHVAVQYAVAMGLHVVAVDVAPEKLALARELGAMLTVDASQQDPAAVIQKEVGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
QFAAEGQVRAHIHRDRLDNINQVLADLKAGKVDGRIVLSLD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtcaatgaaagccgctgtcgtgcacgcgttcggcgaaccgctgcgcatcgag
gaagtccccatcccgacgccgggccgcggacagatcctcgtcaacatccgcgcctccggg
gtctgccacaccgacttgcacgccgccgacggcgactggcccgtcaagccgcgcctgccg
ttcatcccgggacatgagggcgtgggcttcgtggcggcggtgggcgaaggcgtcagcgcc
gtcaaggaaggcgaccgcgtgggcgtgccctggctctacaccgcctgcgggcactgcgag
cattgcctcggcggctgggaaaccctgtgccacgatcagcagaacaccggctactccgtc
aacggcggctatgccgaatacgtactggccgacccgaactatgtcggccacctgcccgcg
caggtcggcttcgaggagatcgcgcccatcctgtgcgcgggcgtgacggtctacaagggc
atccgcatgaccgacacccggcccggccagtggatcgccatctcgggtatcggcgggctg
gggcatgtggcggtgcagtacgccgtcgccatggggctgcacgtggtggcggtggatgtc
gcccccgaaaagctggcgctggcgcgcgaactgggcgccatgctgaccgtcgatgcctcg
cagcaagacccggccgccgtcatccagaaggaggtgggcggcgtgcacggcgtgctggtg
acggcggtctcgcgcagcgccttcgcccaggccctgggcatggtgcggcgcggcggcacc
gtctcgctcaacgggctgccgccgggcgactttccgctaccgatcttctcgacggtgctc
aacggcatcacggtgcgcggctccatcgtcggcacgcggcgcgacctgcaggaatcgctg
cagtttgccgccgaggggcaggtgcgcgctcacatccaccgcgatcgactcgacaacatc
aaccaggtcctcgccgacctgaaggccggcaaggtggacggccgcatcgtcctctcgctg
gattga

DBGET integrated database retrieval system