KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10307Help
Entry
RCFBP_10307       CDS       T01272                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RCFBP_10307 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_10307 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    RCFBP_10307 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RCFBP_10307 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RCFBP_10307 (adhA)
   00626 Naphthalene degradation
    RCFBP_10307 (adhA)
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RCFBP_10307 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(320900..321925)
Genome map
AA seq 341 aa AA seqDB search
MARSMKAAVVHAFGEPLRIEEVPIPTPGRGQILVNIRASGVCHTDLHAADGDWPVKPRLP
FIPGHEGVGFVAAVGEGVSAVKEGDRVGVPWLYTACGHCEHCLGGWETLCHDQQNTGYSV
NGGYAEYVLADPNYVGHLPAQVGFEEIAPILCAGVTVYKGIRMTDTRPGQWIAISGIGGL
GHVAVQYAVAMGLHVVAVDVAPEKLALARELGAMLTVDASQQDPAAVIQKEVGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
QFAAEGQVRAHIHRDRLDNINQVLADLKAGKVDGRIVLSLD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtcaatgaaagccgctgtcgtgcacgcgttcggcgaaccgctgcgcatcgag
gaagtccccatcccgacgccgggccgcggacagatcctcgtcaacatccgcgcctccggg
gtctgccacaccgacttgcacgccgccgacggcgactggcccgtcaagccgcgcctgccg
ttcatcccgggacatgagggcgtgggcttcgtggcggcggtgggcgaaggcgtcagcgcc
gtcaaggaaggcgaccgcgtgggcgtgccctggctctacaccgcctgcgggcactgcgag
cattgcctcggcggctgggaaaccctgtgccacgatcagcagaacaccggctactccgtc
aacggcggctatgccgaatacgtactggccgacccgaactatgtcggccacctgcccgcg
caggtcggcttcgaggagatcgcgcccatcctgtgcgcgggcgtgacggtctacaagggc
atccgcatgaccgacacccggcccggccagtggatcgccatctcgggtatcggcgggctg
gggcatgtggcggtgcagtacgccgtcgccatggggctgcacgtggtggcggtggatgtc
gcccccgaaaagctggcgctggcgcgcgaactgggcgccatgctgaccgtcgatgcctcg
cagcaagacccggccgccgtcatccagaaggaggtgggcggcgtgcacggcgtgctggtg
acggcggtctcgcgcagcgccttcgcccaggccctgggcatggtgcggcgcggcggcacc
gtctcgctcaacgggctgccgccgggcgactttccgctaccgatcttctcgacggtgctc
aacggcatcacggtgcgcggctccatcgtcggcacgcggcgcgacctgcaggaatcgctg
cagtttgccgccgaggggcaggtgcgcgctcacatccaccgcgatcgactcgacaacatc
aaccaggtcctcgccgacctgaaggccggcaaggtggacggccgcatcgtcctctcgctg
gattga

DBGET integrated database retrieval system