KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10393Help
Entry
RCFBP_10393       CDS       T01272                                 

Gene name
glpK
Definition
glycerol kinase (ATP:glycerol 3-phosphotransferase) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RCFBP_10393 (glpK)
Enzymes [BR:rsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RCFBP_10393 (glpK)
Exosome [BR:rsc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCFBP_10393 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(407980..409476)
Genome map
AA seq 498 aa AA seqDB search
MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEHDPLDIWNSQLATCRA
ALEQAKLSAADMAALGITNQRETTVVWERATGRPIFNAIVWQDRRTEAICERLRAEGLEN
EVRKRTGLVIDPYFSGTKLRWILDHVDGARERAARGELAFGTIDSWLVWQLTRGRLHVTD
VSNASRTLLWNIHTGQWDAELMRALDIHPSLLPEVHPSAHRFGQTDADWLGAPLTIGGIA
GDQQSALFGQACFKPGMAKNTYGTGCFMLLNTGERAVESHNGLISTAACQSGAKRSYALE
GSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVVFVPSFTGLGAPYWDPNAQGA
IVGLSRGTTIGHIARAALESIAFQSTALLQAMTRDAVSAISELRVDGGASANNLLLQFQA
DLLGIPVVRPEIIETTALGAAYLAGIATGFYRGEDEVAQQWRASRTFHPVISRDEAQHRM
AQWETAVAQVRLPTTHGR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaatacctcctcgcgctcgaccagggcacctccagttcgcgtgccatcgtgttcaac
cgcgccggccagatcgtcgccagcgcccagcaggagtttccgcagcattttccgcagccc
ggctgggtcgagcacgatccgctcgacatctggaacagccagctcgccacctgccgcgcc
gcgctcgagcaggcgaagctgagcgccgccgacatggctgcgctcggcatcaccaaccag
cgcgagaccaccgtggtgtgggagcgcgccaccggccgccccatcttcaacgccatcgtc
tggcaggaccgccgcaccgaggcgatctgcgaacggctgcgcgccgagggcctggaaaac
gaggtgcgcaagcgcaccgggctggtgatcgatccgtatttctcgggcaccaagctgcgc
tggatcctcgaccacgtggacggcgcccgcgaacgcgccgcgcgcggcgagctggccttc
ggcaccatcgacagctggctggtgtggcagctcacgcgcggccgcctgcatgtgaccgac
gtgtccaacgcctcgcgcaccctgctgtggaacatccacaccggccagtgggatgccgaa
ctgatgcgcgcgctcgacatccatccgagcctgctgccggaggtgcatccgtccgcccat
cgcttcggccagaccgatgccgactggctgggcgcgccgctcaccatcggcggcatcgcc
ggcgaccagcagtcggcgctgttcggccaggcctgcttcaagccgggcatggccaagaac
acctacggcaccggctgcttcatgctgctcaacaccggcgagcgcgcggtcgaatcgcac
aacgggctgatcagcacggcggcctgccagagcggcgcgaaacgcagctacgcgttggaa
ggcagcgtgttcgtcggcggcgcggtggtgcagtggctgcgcgacggcctgcgcgcgatc
cagcgctcggccgacgtggaagggctggccgcctcggtgccggactcgggcggcgtggtg
ttcgtgccgtcgttcaccggcctgggggcgccttactgggacccgaacgcgcagggagcg
atcgtcgggctgtcgcgcggcacgaccatcggccatatcgcgcgggcggcgctggagtcg
atcgcgttccagagcaccgcgctgctgcaggcgatgacgcgcgacgcggtgtcggccatc
tcggagctgcgcgtggacggcggcgcctcggcgaacaacctgctgctgcagttccaggcc
gacctgctcggcattccggtggtgcgcccggagatcatcgagaccacggcgctgggcgcg
gcctacctggccggcatcgccaccggcttctaccggggcgaggacgaggtcgcgcagcaa
tggcgcgcctcgcgcacgttccaccccgtcatcagccgcgacgaagcgcagcaccgcatg
gcgcagtgggagacggcggtggcgcaggtgcggttgccgaccacgcacggccgctga

DBGET integrated database retrieval system