KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10428Help
Entry
RCFBP_10428       CDS       T01272                                 

Gene name
tufB
Definition
protein chain elongation factor ef-tu
Orthology
K02358  
elongation factor Tu
Organism
rsc  Ralstonia solanacearum CFBP2957
Brite
Mitochondrial biogenesis [BR:rsc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RCFBP_10428 (tufB)
Exosome [BR:rsc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RCFBP_10428 (tufB)
  Exosomal proteins of breast cancer cells
   RCFBP_10428 (tufB)
  Exosomal proteins of colorectal cancer cells
   RCFBP_10428 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
457021..458211
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDSYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVIK
VGEEIEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPEGKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggaccaagccgcacgtgaacgttgggacgatcggtcac
gttgaccacggcaagacgacgctgacggccgcaatcgcgacggtgctgtcgagcaagttc
ggtggcgaagcgaagaagtacgacgaaatcgatgcagcgccggaagaaaaggcacgcggc
atcaccatcaacaccgcgcatatcgagtacgaaacggccaaccgccactacgcacacgtc
gactgcccgggccacgccgactacgtcaagaacatgatcaccggtgccgcccagatggac
ggcgccatcctggtggtctccgccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggctcgccaggtgggcgtgccgtacatcatcgtcttcctgaacaagtgcgacatg
gtggacgacgctgagctgctggagctggtcgaaatggaagtgcgcgagctgctctccaag
tacgacttcccgggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgaactgggcgaagtggccatcatgaacctggccgacgccctggactcc
tacatcccgacgccggagcgcgccgttgacggcacgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgtatcgagcgcggcgtgatcaag
gtcggcgaagaaatcgaaatcgtcggcatcaaggccacgcaaaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccaaggccaggctggcgacaacgtcggtatcctg
ctgcgcggcaccaagcgtgaagacgtcgagcgaggccaagtgctgtgcaagccgggttcg
atcaagccgcacacgcacttcaccggcgaggtctacatcctgtcgaaggacgaaggtggc
cgtcacaccccgttcttcaacaactaccgcccgcagttctacttccgtaccacggacgtg
accggctcgatcgagctgccggaaggcaaggaaatggtcatgcccggcgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaggaaggcctgcgcttcgccatccgt
gaaggcggtcgtaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system