KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10428Help
Entry
RCFBP_10428       CDS       T01272                                 

Gene name
tufB
Definition
protein chain elongation factor ef-tu
Orthology
K02358  
elongation factor Tu
Organism
rsc  Ralstonia solanacearum CFBP2957
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
457021..458211
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDSYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVIK
VGEEIEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPEGKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggaccaagccgcacgtgaacgttgggacgatcggtcac
gttgaccacggcaagacgacgctgacggccgcaatcgcgacggtgctgtcgagcaagttc
ggtggcgaagcgaagaagtacgacgaaatcgatgcagcgccggaagaaaaggcacgcggc
atcaccatcaacaccgcgcatatcgagtacgaaacggccaaccgccactacgcacacgtc
gactgcccgggccacgccgactacgtcaagaacatgatcaccggtgccgcccagatggac
ggcgccatcctggtggtctccgccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggctcgccaggtgggcgtgccgtacatcatcgtcttcctgaacaagtgcgacatg
gtggacgacgctgagctgctggagctggtcgaaatggaagtgcgcgagctgctctccaag
tacgacttcccgggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgaactgggcgaagtggccatcatgaacctggccgacgccctggactcc
tacatcccgacgccggagcgcgccgttgacggcacgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgtatcgagcgcggcgtgatcaag
gtcggcgaagaaatcgaaatcgtcggcatcaaggccacgcaaaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccaaggccaggctggcgacaacgtcggtatcctg
ctgcgcggcaccaagcgtgaagacgtcgagcgaggccaagtgctgtgcaagccgggttcg
atcaagccgcacacgcacttcaccggcgaggtctacatcctgtcgaaggacgaaggtggc
cgtcacaccccgttcttcaacaactaccgcccgcagttctacttccgtaccacggacgtg
accggctcgatcgagctgccggaaggcaaggaaatggtcatgcccggcgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaggaaggcctgcgcttcgccatccgt
gaaggcggtcgtaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system