KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10461Help
Entry
RCFBP_10461       CDS       T01272                                 

Gene name
hemB
Definition
5-aminolevulinate dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCFBP_10461 (hemB)
Enzymes [BR:rsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RCFBP_10461 (hemB)
Exosome [BR:rsc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCFBP_10461 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(475579..476538)
Genome map
AA seq 319 aa AA seqDB search
MRRDDFSRRMMRESRLSADDLIYPVFILEGTNVRQAVPSMPGVERVSVDVLLGVAEQCVQ
LGIPVLALFPVIEPNLKTPDGIEATNANGLIPRAVKALKARFPELGILTDVALDPYTSHG
QDGVLDDTGYVLNEETVDILTRQALVQAEAGVDIVAPSDMMDGRIGAIRLALENEDHIYT
RIMAYAAKYASAFYGPFRDAVGSAANLGKSNKMTYQMDPANSDEALREVALDIAEGADMV
MVKPGMPYLDIVRRVKDEFRFPTYVYQVSGEYAMLKAAAQNGWLDHDKVVLESLLAFKRA
GANGILTYFALDAARLLRG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgacgacttctcccgccggatgatgcgcgaatcgcgcctgtcggccgacgac
ctgatctatccggtcttcatcctggaaggcaccaacgtgcggcaagccgtaccgtcgatg
ccgggggtcgagcgcgtctccgtcgacgtgctgctgggcgtggccgagcaatgcgtgcag
ctcgggattccggtgctggcgctcttccccgtcatcgaaccgaacctgaagacgccggac
ggcatcgaagccaccaatgccaacgggctgattccccgcgcggtcaaggcgctcaaggcg
cgcttcccggagctcggcatcctcaccgacgtcgcgctcgatccgtacaccagccacggc
caggacggcgtgctcgatgacaccggctacgtgctcaacgaagaaacggtcgacatcctg
acgcgccaggcactggtgcaggccgaggccggcgtggacatcgtcgccccgtcggacatg
atggacggccgcatcggtgcgatccgcctggcgctggagaacgaggatcacatctacacg
cgcatcatggcctacgcggccaaatatgcgtcggcgttctacggcccgttccgcgatgcg
gtgggttcggcggccaacctgggcaagagcaacaagatgacctaccagatggatccggcc
aactccgacgaggcgctgcgcgaagtggcgctggacatcgcagagggcgccgacatggtg
atggtcaagccgggcatgccgtacctcgacatcgtgcgccgcgtgaaagacgagttccgc
ttcccgacctacgtctaccaggtcagcggcgaatacgcgatgctcaaggccgccgcccag
aacggctggctggaccacgacaaagtcgtgctggaatcgctgctggcattcaagcgggcc
ggcgccaacggcatcctgacctacttcgcactggacgccgcgcgtctgctgcgcggctga

DBGET integrated database retrieval system