KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10499Help
Entry
RCFBP_10499       CDS       T01272                                 

Gene name
hisD
Definition
histidinol dehydrogenase (hdh) (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCFBP_10499 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    RCFBP_10499 (hisD)
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RCFBP_10499 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
516974..518302
Genome map
AA seq 442 aa AA seqDB search
MSLTIRKLDSADAGFAAQLRQVLAFEASEDEAIDRAAAQILADVKARGDAAVLETTHRFD
RIEADSVAALELSPAALQAALDGLEPKRRAALEAAAARVRAYHEKQKIECGSHSWEYAEA
DGTVLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPARVAGVKEIIMVVPTPGGVRNELV
LAAACIAGVDRVFTIGGAQAVGALAYGTETVPAVDKIVGPGNAYVAAAKRRVFGTVGIDM
IAGPSEILVICDGTTDPDWVAMDLFSQAEHDELAQSILLCPDAGFIAQVEASIRRLLDDM
PRKDVIAASLSGRGALIRVRDMDEACEIANDIAPEHLEISAEHPRQWAERIRHAGAIFLG
KYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRSSLIEVSEAGAQMLGEIASELA
YGEGLQAHARSAEYRLQRTTTE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaccatccgcaaactggattcggccgatgccggattcgcggcgcaactgcgc
caggtgctcgccttcgaagcgagcgaagacgaagccatcgaccgcgccgccgcgcagatc
ctggccgatgtgaaggcgcgcggcgacgccgccgtgctcgagaccacgcaccgctttgac
cgcatcgaagccgatagcgtggccgcgctggaactgtcgccggccgcgctgcaggccgcg
ctcgatgggctggagcccaagcgccgcgccgcgctggaggccgccgccgcccgcgtgcgc
gcctaccatgagaagcagaagatcgagtgcggctcgcacagctgggagtacgcggaagcc
gacggcaccgtgctcggccagaaggtcacgccgctcgatcgcgtcggcatttacgtgccg
ggcggcaaggcggcgtacccttcgtcggtgctgatgaatgcgattccggcgcgcgtggcg
ggcgtcaaggaaatcatcatggtggtgcccacgcccggcggcgtgcgcaacgagctggtg
ctggccgcggcctgcatcgccggggtggaccgcgtgttcaccatcggcggcgcgcaggct
gtcggggcgctcgcttatggcaccgagaccgtgcccgccgtcgacaagatcgtcggcccg
ggcaacgcctacgtggcggcggccaagcggcgcgtgttcggcacggtcggcatcgatatg
attgccgggccatccgagatcctcgtcatctgcgacggcaccaccgatccggactgggtg
gcgatggacctgttctcgcaggccgagcacgacgagcttgcgcagtcgatcctgctgtgt
ccggacgccggcttcatcgcccaggtggaggccagcatccggcgcctgcttgacgacatg
ccgcgcaaggacgtgatcgccgcctcgctgtcgggccgcggggcgctgatccgggtacgc
gacatggacgaggcgtgcgagatcgccaacgacatcgcgccggagcacctggagatctcc
gccgagcacccgcgccagtgggccgagcgcatccgccacgcgggcgccatcttcctcggc
aagtacaccagcgagtcgctgggcgactactgcgcgggcccgaaccacgtgctgccgacc
tcgcgcacggcgcgcttctcgtcgccgctgggcgtgtacgacttcatcaagcgctccagc
ctgatcgaagtgagcgaagcgggcgcgcagatgctgggcgagatcgcctccgagctggcc
tacggcgagggtttgcaggcgcacgcccgcagcgccgaataccgcctgcaacgcacgacc
accgagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system