KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10564Help
Entry
RCFBP_10564       CDS       T01272                                 

Definition
thiol:disulfide interchange protein (dsbc-like)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Brite
Enzymes [BR:rsc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     RCFBP_10564
Secretion system [BR:rsc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   RCFBP_10564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580819..581565
Genome map
AA seq 248 aa AA seqDB search
MSFRIRVAAIASAALVAAMGAGYALTAGAAEPALDKVKVSVQKALGPSVEIKGVAKSPLP
GLYEVNLGNQVVYTDATGRYVLNGDLLDTQTATNLTQERMTEINRVKWSDLPLDQAVKWV
KGNGARKIAVFSDPNCPYCHKLEQMFSQVDNITVYTFLLPILSEDSSVKAKQIWCSADRA
KAWRDWMVSKSAPGGAGNCDTPLEDNLKLGRALNVNGTPAIIFMDGSRAPGLIDAAALER
KFASLKKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcgtattcgggtggcggccatcgcttcggcggcgctggtcgccgccatgggc
gcgggttacgcgctgaccgccggtgccgccgagcccgcgctggacaaggtcaaggtgtcg
gtgcagaaggcgctggggccgagcgtggaaatcaagggcgtcgccaagtcgccgctgccg
gggctgtacgaggtgaatctcggcaatcaggtcgtctacaccgacgccaccggccgctac
gtgctcaacggcgacctgctcgatacgcagaccgccaccaacctgacgcaggagcgcatg
acggagatcaaccgcgtcaagtggtccgatctgccgctggaccaagcggtgaagtgggtc
aagggcaacggcgcgcgcaagatcgccgtgttctccgacccgaactgcccgtactgccac
aagctggagcagatgttctcgcaggtcgacaacatcacggtctacaccttcctgttgccg
atcctgtctgaagattccagcgtcaaggccaagcagatctggtgctcggccgaccgtgcc
aaggcctggcgcgactggatggtgtccaagagcgccccgggcggtgccggcaattgcgat
acgccgctggaggacaacctgaagctgggccgcgcgctcaacgtcaacggcaccccggcg
atcatcttcatggatggctcgcgggcgccgggcctgatcgatgcggccgcgctggagcgc
aagtttgcgtcgctgaagaagtcgtaa

DBGET integrated database retrieval system