KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10564Help
Entry
RCFBP_10564       CDS       T01272                                 

Definition
thiol:disulfide interchange protein (dsbc-like)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580819..581565
Genome map
AA seq 248 aa AA seqDB search
MSFRIRVAAIASAALVAAMGAGYALTAGAAEPALDKVKVSVQKALGPSVEIKGVAKSPLP
GLYEVNLGNQVVYTDATGRYVLNGDLLDTQTATNLTQERMTEINRVKWSDLPLDQAVKWV
KGNGARKIAVFSDPNCPYCHKLEQMFSQVDNITVYTFLLPILSEDSSVKAKQIWCSADRA
KAWRDWMVSKSAPGGAGNCDTPLEDNLKLGRALNVNGTPAIIFMDGSRAPGLIDAAALER
KFASLKKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcgtattcgggtggcggccatcgcttcggcggcgctggtcgccgccatgggc
gcgggttacgcgctgaccgccggtgccgccgagcccgcgctggacaaggtcaaggtgtcg
gtgcagaaggcgctggggccgagcgtggaaatcaagggcgtcgccaagtcgccgctgccg
gggctgtacgaggtgaatctcggcaatcaggtcgtctacaccgacgccaccggccgctac
gtgctcaacggcgacctgctcgatacgcagaccgccaccaacctgacgcaggagcgcatg
acggagatcaaccgcgtcaagtggtccgatctgccgctggaccaagcggtgaagtgggtc
aagggcaacggcgcgcgcaagatcgccgtgttctccgacccgaactgcccgtactgccac
aagctggagcagatgttctcgcaggtcgacaacatcacggtctacaccttcctgttgccg
atcctgtctgaagattccagcgtcaaggccaagcagatctggtgctcggccgaccgtgcc
aaggcctggcgcgactggatggtgtccaagagcgccccgggcggtgccggcaattgcgat
acgccgctggaggacaacctgaagctgggccgcgcgctcaacgtcaacggcaccccggcg
atcatcttcatggatggctcgcgggcgccgggcctgatcgatgcggccgcgctggagcgc
aagtttgcgtcgctgaagaagtcgtaa

DBGET integrated database retrieval system