KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10694Help
Entry
RCFBP_10694       CDS       T01272                                 

Gene name
RNASA
Definition
guanyl-specific ribonuclease sa3 (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rsc  Ralstonia solanacearum CFBP2957
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726742..727125
Genome map
AA seq 127 aa AA seqDB search
MARGALAAMLALSAAGLPATAAARDTTGMAVVMGTIPAADLPNEAQRTLVLIEQGGPFPY
AKDGTTFGNYEGGLPARKRGYYHEYTVKTRGARNRGARRIICGGDQRAANDCYYTQDHYN
SFQRIQR
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggggtgcgctggcggcgatgcttgcgctgtccgccgccgggttgccggcgacg
gctgctgcccgggacaccaccggcatggcagtggtgatgggaaccattcctgcggcggac
ctgcccaatgaggcgcagcgcacgctggtgctgatcgagcagggtggtccgtttccctat
gcgaaagatggcaccacgttcggcaattatgagggcggtttgccagcacgcaagcgtggc
tactatcacgaatacaccgtgaagacgcgtggtgcgcgcaatcgtggcgccagacgcatc
atctgcggcggcgaccagcgcgcggccaacgattgctactacacgcaagatcactacaac
agctttcaacggatacagcgatga

DBGET integrated database retrieval system