KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10694Help
Entry
RCFBP_10694       CDS       T01272                                 

Gene name
RNASA
Definition
guanyl-specific ribonuclease sa3 (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rsc  Ralstonia solanacearum CFBP2957
Brite
Enzymes [BR:rsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     RCFBP_10694 (RNASA)
Messenger RNA biogenesis [BR:rsc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     RCFBP_10694 (RNASA)
Transfer RNA biogenesis [BR:rsc03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    RCFBP_10694 (RNASA)
 Prokaryotic Type
    RCFBP_10694 (RNASA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726742..727125
Genome map
AA seq 127 aa AA seqDB search
MARGALAAMLALSAAGLPATAAARDTTGMAVVMGTIPAADLPNEAQRTLVLIEQGGPFPY
AKDGTTFGNYEGGLPARKRGYYHEYTVKTRGARNRGARRIICGGDQRAANDCYYTQDHYN
SFQRIQR
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggggtgcgctggcggcgatgcttgcgctgtccgccgccgggttgccggcgacg
gctgctgcccgggacaccaccggcatggcagtggtgatgggaaccattcctgcggcggac
ctgcccaatgaggcgcagcgcacgctggtgctgatcgagcagggtggtccgtttccctat
gcgaaagatggcaccacgttcggcaattatgagggcggtttgccagcacgcaagcgtggc
tactatcacgaatacaccgtgaagacgcgtggtgcgcgcaatcgtggcgccagacgcatc
atctgcggcggcgaccagcgcgcggccaacgattgctactacacgcaagatcactacaac
agctttcaacggatacagcgatga

DBGET integrated database retrieval system