KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10976Help
Entry
RCFBP_10976       CDS       T01272                                 

Definition
fatty acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rsc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rsc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008716..1010044
Genome map
AA seq 442 aa AA seqDB search
MPGIRLPAEKPPLLLQSSDTSGPDDAAPSIPTQAASNHPELTTEMNLIDSFMRFLANGTL
NWAWWQILIFTLAVTHMTIASVTIFLHRCQAHRALDLHPAAAHVFRFWLWLTTGMVTKEW
AAIHRKHHAKCETEDDPHSPQTRGIRKVLLEGAELYRAESKNRETIQKFGHGTPNDWIEQ
NLYSKYTWQGVGLMLILDVLMFGAVGLTVWAVQMLWIPVHAAGIINGLGHYWGYRNFDCE
DASTNVFPWGLIIGGEELHNNHHTYATSAKFSIKWYEFDVGWGYIRALEMVGLAKVKKVA
PKARFGDVKPVDQNTLEAIIANRYDVMARYAKTVKAAYRQELAKLKADRDVEYCALKPAS
KWFHRDEAKLGAPQREQLSQIVSDHSALHTFVEMRRELGALWGRSNATREQLLHQLQEWC
KRAEESGIHALQEFALRLRRYA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcatccgacttcccgccgaaaagccgcccctgttgttgcagtcaagcgacaca
agtgggcccgatgacgcagcaccgtcgatcccgacccaggctgcttcgaatcaccccgag
ttgaccacggagatgaacttgatcgactcctttatgcgtttccttgccaacggcaccctg
aactgggcttggtggcaaatcctgattttcacgctggcggtgacgcacatgaccatcgcc
agcgtcacgattttcctgcatcgctgccaggcgcaccgcgcgctggatctgcatccggct
gccgcgcacgtcttccgcttctggctctggctgaccacgggcatggtcaccaaggagtgg
gctgcgattcaccgcaagcaccacgccaagtgcgaaaccgaagacgatccgcacagcccg
cagacgcgcggcattcgcaaggtgctgctggaaggcgccgagctgtaccgcgccgagtcc
aagaaccgcgagaccatccagaaattcggtcacggcacgcccaacgactggatcgagcag
aacctctattccaagtacacctggcagggcgtcggcctgatgctgatcctcgacgtgctg
atgttcggcgcggtaggcctgactgtgtgggcggtgcagatgctgtggattccggtgcat
gccgccggcatcatcaacgggctgggccactactggggctatcgcaacttcgattgcgaa
gacgcttcgaccaacgtgttcccgtggggtctgatcatcggtggcgaagagctgcacaac
aatcaccacacgtacgccacgtcggccaagttctcgatcaagtggtacgagttcgatgtg
ggctggggctacatccgcgcgctggagatggtgggcctggccaaggtcaagaaggtggcg
cccaaggcacgcttcggtgatgtcaaaccggtcgatcagaacacgctggaagccatcatc
gccaaccgctacgacgtgatggcccgctatgccaagaccgtcaaggccgcttaccgccag
gagctggccaagctgaaggctgaccgtgacgtggaatactgcgcgctgaagccggccagc
aagtggttccatcgcgatgaagccaagctgggcgcaccccagcgcgaacagctgtcgcag
atcgtgtcggaccattccgcgctgcacactttcgtcgagatgcgccgcgagctgggcgca
ttgtggggacgttcgaacgccacgcgcgagcagctgctgcaccagttgcaggaatggtgc
aagcgggcggaggaaagcggtatccatgcgttgcaggagtttgccctgcgcctgcgccgc
tacgcctga

DBGET integrated database retrieval system