KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11075Help
Entry
RCFBP_11075       CDS       T01272                                 

Definition
bifunctional uroporphyrin-III c-methyltransferase and uroporphyrinogen-III synthase transmembrane protein (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCFBP_11075
Enzymes [BR:rsc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     RCFBP_11075
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RCFBP_11075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1118042..1120156
Genome map
AA seq 704 aa AA seqDB search
MTFRPAMDDRLPSPSSVPPDALPHASAPVVVVTRPRAQAPMLVAALERHGLRTLQFPLLD
IAPTPNLDDLRAALADPSRYALVVFVSPNAVQQAFSAMPEGFRWPQDVPVAVVGPASAQA
LAAHGVEPPTHSVIRPDTHADDARQDSEALYARLDPAQLSGREVLIVRGNGGREWLADRL
REAGVAVRTVEAYRRSVPVPDAAAWAALREVLAGRHAWTLTSSEAVRNLDSLARASLTAA
EVDTLHAAPCFAPHARIVEQAQSLGFRDVTLTGAGDDRLLAGLLAWVAPAAPVAPAAEAV
PSPAPAAAPAEPKPSSPAPIVSQTSAPSSVPASGPAAASPGPAAAPAAPTTTVSARPGRG
NWLLWAALTAVLVVVAGLQVRNERLAREVRQRAQQNETLAQEMRVLSRNDQDAFAQLQQK
FGALDARTAETRDRQGALEQASQDLLRNRDDWQRSEIERSLEVASEQLQLTGNVSSALVA
LQTIDARLASLDKPQFRAMRRAVARDIAKLKALPAIDLSGAAIRLDDAINGIDALPLVSA
ALPLEPQPAAQAPHGRPAKPAKAAAPASAPAAPVAAQSGWSAGMRAWWGRLWHDVRHELG
QIVQVRRVDQTEALLLSSDQAWFLRENLKLWLMNARLALLSRNDAVFRADLGRADALLAR
YFDPQSPRVVAEQTLLQQARASVGTLEVPTLADSLAAARGQGKE
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
ttgaccttccggcccgccatggacgaccgcttgccctctccatccagcgtgccgcccgac
gctctcccgcatgcttccgcgcccgtcgtcgtggtcacgcggccgcgtgcgcaggcgccc
atgctggtcgccgcgctggagcgccatgggctgcgcacgctccagtttccgctgctcgac
atcgcacccacgcccaacctggacgacctgcgcgccgcgctggccgatccgtcgcgctat
gcgctggtcgtgttcgtcagtcccaacgccgtgcagcaggcgttttcggccatgcccgaa
ggcttccgctggccgcaggacgtgccggtcgcggtggtcggccccgccagcgcccaggcc
ctggccgcgcacggggtcgagccgcccacgcacagtgtgatccggcccgacacgcatgcc
gacgacgcgcggcaggattccgaggcgctgtacgcgcgcctggacccggcgcaactgagc
ggccgcgaggtgctgatcgtgcgtggcaacggcggccgcgaatggctggccgaccggttg
cgcgaagccggcgtcgcggtgcgcacggtggaagcgtatcggcgcagcgtcccggtgccc
gacgccgcagcctgggccgcgctgcgcgaggtgctggccggccgccacgcctggacgctg
accagctccgaggcggtgcgcaatctcgacagcctcgcgcgcgccagcctgacggccgcc
gaagtcgacacgctgcacgccgcgccatgctttgcgccgcacgcccgcattgttgaacag
gcgcagtcgctgggctttcgtgacgtgacgctgaccggcgcgggcgacgaccgcctgctg
gccggcctgctggcctgggtcgcgcccgccgcacctgtcgcgcccgccgccgaggccgtg
ccgtcgccagcacccgcggcggcgccggccgaaccgaaaccttcctcacctgctccgatc
gtgtcgcagacttccgctccctcgtccgttcccgcatcgggcccggcagccgcctcgcca
gggccggcggccgcgcctgccgccccgaccacgactgtcagcgcgcgccccggccgcggc
aactggctgctctgggctgcgctgaccgcggtactggtagtcgtggccggcctgcaggtc
cgcaatgagcggctggcccgcgaagtccgccagcgcgcgcagcagaacgagacgctggcg
caggagatgcgcgtgctgtcgcgcaacgaccaggatgcctttgcccaactgcagcagaag
ttcggcgcactggatgcccgtaccgccgaaacgcgcgaccgccagggcgcgctcgagcag
gccagccaggatctgctgcgcaaccgcgacgactggcagcggtccgagatcgagcgctcg
ctcgaagtcgcctccgagcaattgcagctcaccggcaacgtgagcagtgcgctggtcgcg
ctgcagaccatcgacgcgcgcctggcctcgctcgacaagccgcagttccgcgccatgcgc
cgcgccgtcgcccgcgatatcgccaagctcaaggcgctgccggccatcgacttgtcgggc
gctgcgatccggctggacgatgcgatcaacggcatcgatgcgctaccgctggtgtcggcc
gccttgccgctggaaccgcagccggccgcgcaggcgccgcatggccggcccgccaagccg
gccaaggctgcggcgccggcttcggcacccgccgcgccggtggcggcgcagtccggctgg
tcggccggcatgcgcgcctggtggggccgcctgtggcacgacgtgcgccacgagttgggc
cagatcgtgcaggtgcgccgcgtcgaccagaccgaggcgctgctgctgtcgtccgatcag
gcgtggttcctgcgcgagaacctcaagctgtggctgatgaacgcgcggctggcgctgctg
tcgcgcaacgatgcggtgttccgcgccgacctcggccgcgccgacgcgctgctcgcgcgc
tatttcgatccgcagtcgccgcgtgtcgtggctgagcagaccctgttgcagcaggcgcgc
gcgagcgtcggtacgctggaggtgccgaccttggccgacagcctcgccgccgcccgcggc
cagggcaaggagtga

DBGET integrated database retrieval system